Detailed information on CNT30531736


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30531736

Peptides detected in this lncRNA

>peptide 1 (34 aa)
MLSSPTSSPCPLCAGAKRDRAYEAGIWLRTSGFG*

>peptide 2 (37 aa)
SPFFSLDDDGHGIPQFLLIRIDVRRLSICASTIGTLV*

Sequence

>CNT30531736
TCTCACCCTTTTTCTCTCTTGATGACGATGGACACGGTATTCCGCAATTCCTGCTAATTAGAATCGACGTGCGAAGGTTGAGCATTTGCGCTTCAACCAT
CGGAACCCTTGTTTGAAAGAAGCCTTGAACTTGCCTTCGACCGAATAAAGCTTGTATCTGGCCACCCTCCTCTTCCTCTTCTTCTCCGGGTCATTCCACC
GCGATGCTTTCATCGCCAACTTCTTCGCCTTGTCCACTTTGTGCGGGGGCGAAGCGTGATCGAGCATACGAGGCCGGCATTTGGCTACGTACATCTGGTT
TTGGTTAAGAGTTTGAATCGTCATGATCTCTAGACTCCGGCCAACTCCATGCGA