Detailed information on CNT30530404


BLAST search results

BLAST vs Swiss-Prot:
sp|Q8S8T4|UXS4_ARATH, E-value = 4e-75

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30522345Eucalyptus grandisSetaria italica92.1143.685.93327forward
CNT30316147Eucalyptus grandisCorylus avellana98.0346.7187.07348forward
CNT30703138Eucalyptus grandisQuercus lobata92.6862.7982.07329forward
CNT30499549Eucalyptus grandisCoffea canephora95.2168.9881.95338forward
CNT30615836Eucalyptus grandisSesamum indicum39.1536.2984.17139forward
CNT3020608Eucalyptus grandisCitrullus lanatus60.5648.7580.93215forward
CNT30729539Eucalyptus grandisCorchorus capsularis66.4835.1282.63236forward
CNT3068683Eucalyptus grandisQuercus suber92.6866.8782.98329forward
CNT30524728Eucalyptus grandisPhaseolus vulgaris95.2162.5981.36338forward
CNT30486152Eucalyptus grandisOlea europaea57.1822.4379.31203forward
CNT30503775Eucalyptus grandisNicotiana attenuata41.1332.9682.19146forward
CNT30182233Eucalyptus grandisSecale cereale66.4837.9487.71236forward
CNT30289293Eucalyptus grandisTriticum aestivum63.3874.0186.67225forward
CNT30223417Eucalyptus grandisHordeum vulgare58.8792.0789.47209forward
CNT30590847Eucalyptus grandisMusa acuminata62.5448.5884.23222forward
CNT3084565Eucalyptus grandisVigna radiata95.212080.18338forward
CNT30539234Eucalyptus grandisBrassica napus91.2735.4184.26324forward
CNT30145616Eucalyptus grandisMedicago truncatula56.3444.0580.5200forward
CNT30244810Eucalyptus grandisAvena sativa84.233783.61299forward
CNT30261302Eucalyptus grandisBrassica rapa94.6564.9983.63336forward
CNT30447453Eucalyptus grandisSaccharum spontaneum98.3160.9184.81349forward
CNT30131528Eucalyptus grandisLolium perenne88.1767.984.35313forward
CNT30231964Eucalyptus grandisAnanas comosus48.4514.185.47172forward
CNT3066796Eucalyptus grandisLeersia perrieri58.0352.9688.35206forward
CNT30653881Eucalyptus grandisRosa chinensis98.0332.5885.34348forward
CNT30718631Eucalyptus grandisMalus domestica golden10061.8583.66355forward
CNT30339698Eucalyptus grandisEragrostis tef97.1827.9484.64345forward
CNT30477892Eucalyptus grandisArabidopsis halleri94.6531.481.85336forward
CNT30363710Eucalyptus grandisSorghum bicolor57.4634.7589.22204forward
CNT30595456Eucalyptus grandisOryza meridionalis66.4841.487.71236forward
CNT30359656Eucalyptus grandisLactuca sativa60.5612.7281.86215forward
CNT30570592Eucalyptus grandisVitis vinifera65.6372.1485.84233forward
CNT30645151Eucalyptus grandisCannabis sativa69.8626.0281.05248forward
CNT3055709Eucalyptus grandisAmborella trichopoda76.941.7479.49273forward
CNT30105598Eucalyptus grandisOryza longistaminata97.1850.0784.93345forward
CNT30319856Eucalyptus grandisAsparagus officinalis62.5479.2985.59222forward
CNT30574680Eucalyptus grandisOryza barthii97.1837.6684.93345forward
CNT30580197Eucalyptus grandisEchinochloa crusgalli97.4641.9984.1346forward
CNT30499107Eucalyptus grandisDigitaria exilis74.0867.2686.69263forward
CNT30115589Eucalyptus grandisOryza nivara97.1824.1884.93345forward
CNT30594668Eucalyptus grandisEragrostis curvula78.0382.283.03277forward
CNT30603529Eucalyptus grandisOryza punctata97.1845.185.51345forward
CNT30174824Eucalyptus grandisVigna angularis70.726.4282.07251forward
CNT30550386Eucalyptus grandisOryza brachyantha57.1873.8289.16203forward
CNT30337932Eucalyptus grandisCynara cardunculus68.1729.5183.47242forward
CNT30723923Eucalyptus grandisLupinus angustifolius41.9772.6880.54149forward
CNT3064271Eucalyptus grandisSelaginella moellendorffii64.2341.4583.77228forward
CNT3050773Eucalyptus grandisCucumis sativus47.8930.2581.76170forward

Expression of CNT30530404

Peptides detected in this lncRNA

>peptide 1 (47 aa)
DGVDVAPVGLDLGMLKGIAVNLASAGEQETCPDPLRQPQHVERSHHI*

>peptide 2 (40 aa)
MGSTTSWRMSSNRGFPKWCATLSFRPVKKLSTTITLSPRAI

Sequence

>CNT30530404
CCGATGGGGTTGACGTTGCCCCAGTAGGTCTCGACCTGGGGATGCTGAAGGGGATCGCCGTAAACCTCGCTAGTGCTGGTGAGCAAGAAACGTGCCCCGA
CCCTCTTCGCCAGCCCCAACATGTTGAGCGTTCCCACCACATTTGATATGATGGTCTTGACGGGGTTGAACTTGTAGTGGACGGGGGAGGCCGGGCAGGC
GAGGTGGTAGATCTGGTCCACCTCCAGGAGGATGGGCTCGACCACGTCGTGGCGGATGAGCTCGAACCGGGGGTTCCCGAAGTGGTGCGCCACGTTGTCC
TTCCGCCCCGTGAAGAAGTTGTCCACCACGATCACGCTGTCCCCGCGCGCGATCA