Detailed information on CNT30528288


BLAST search results

BLAST vs Swiss-Prot:
sp|P69309|UBIQP_AVEFA, E-value = 6e-158

BLAST vs NONCODE:
NONMEST001181, E-value = 3e-136

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30674319Eucalyptus grandisSetaria viridis61.3482.4587.96822forward
CNT30546269Eucalyptus grandisIpomoea triloba61.6491.9885.23826forward
CNT30526024Eucalyptus grandisPhaseolus vulgaris68.3669.2485.37916forward
CNT30193041Eucalyptus grandisSecale cereale68.4347.5487.68917forward
CNT30305252Eucalyptus grandisTriticum aestivum56.7989.1187.12761forward
CNT30226205Eucalyptus grandisHordeum vulgare68.3688.7687.34916forward
CNT3089455Eucalyptus grandisVigna radiata67.9174.8484.4910forward
CNT30312659Eucalyptus grandisCamelina sativa68.8846.8885.48923forward
CNT3061767Eucalyptus grandisArabidopsis lyrata68.2856.0384.15915forward
CNT307928Eucalyptus grandisZea mays65.673.7486.23879forward
CNT30608559Eucalyptus grandisGossypium raimondii66.5758.4584.75892forward
CNT30217431Eucalyptus grandisKalanchoe fedtschenkoi68.2867.5886.01915forward
CNT30716337Eucalyptus grandisMalus domestica golden68.7374.3386.1921forward
CNT30359535Eucalyptus grandisLactuca sativa68.2154.1185.23914forward
CNT30593897Eucalyptus grandisEragrostis curvula68.2181.3986.11914forward
CNT30174646Eucalyptus grandisVigna angularis66.5785.687.78892forward
CNT3066362Eucalyptus grandisSelaginella moellendorffii68.0692.4985.31912forward

Expression of CNT30528288

Peptides detected in this lncRNA

>peptide 1 (33 aa)
MLYRQGCGRPRAACREMSLCWSGGIPSLSWILA*

>peptide 2 (67 aa)
MPSLSWILAFTLSMVSELSTSRVMVLPVRVLTKICMPPLSLSTSGGWTPSGCCIGKGAAVLELLAAR*

>peptide 3 (87 aa)
MVSELSTSRVMVLPVRVLTKICICRAPKRDHKFKPPLQPSQPRNQENANNTKPRKPKIQDQNVYGKRRKPNSQIAKNGEIGDREALP*

>peptide 4 (36 aa)
WSNAQSIGLKNHFIQLKLRIDSQAPDDREPIGPDFT*

>peptide 5 (40 aa)
MVSELSTSKVMVLPVRVLTKICMPPLSLSTRWRVDSFWML*

Sequence

>CNT30528288
ATGGAGTAATGCACAGAGTATAGGATTAAAAAACCATTTTATTCAATTGAAACTAAGGATTGATTCACAAGCCCCAGACGATCGGGAACCCATCGGCCCC
GATTTCACATAAACACTTTCAAAGAAATTCATTCATAACAACCCTCGTCCATAGAGACGACCAACTTTCAAGCAGACACAACCACTTAGAATCCACCACG
AAGACGGAGCACGAGGTGAAGGGTCGACTCCTTCTGGATGTTGTAATCCGCCAGGGTGCGGCCGTCCTCCAGCTGCTTGCCGGCGAAGATCAGCCTCTGC
TGGTCCGGGGGGATGCCCTCCTTGTCCTGGATCTTGGCCTTCACGTTGTCGATGGTGTCGGAGCTCTCCACCTCCAGGGTGATGGTCTTGCCGGTGAGGG
TCTTGACGAAGATCTGCATGCCTCCCCTGAGCCTCAGCACAAGTGGAGGGTGGACTCCTTCTGGATGTTGTATCGGCAAGGGTGCGGCCGTCCTCGAGCT
GCTTGCCGCGAGATGAGCCTCTGCTGGTCCGGGGGAATTCCTTCCTTGTCATGGATCTTGGCCTGACGTTGTCGATGGTGTCAGAGCTCTCAACCTCGAG
GGTGATGGTCTGCCGGTGAGGGTCTTGACGAAGATCTGCATACCTCCACGAAGACGGAGGACAAGGTGAAGGGTGGACTCCTTCTGGATGTTGTAGTCAG
CAAGGGTGCGGCCATCCTCAAGCTGCTTTCCGGCGAAGATCAGCCTCTGCTGGTCCGGGGGAATTCCTTCCTTGTCCTGGATCTTGGCCTTGACGTTGTC
GATGGTGTCAGAGCTCTCGACCTCCAAGGTTATGGTCTTGCCGGTGAGGGTCTTGACGAAGATCTGCATGCCTCCCCTGAGCCTGAGCACAAGGTGGAGG
GTCGATTCCTTCTGGATGTTGTAGTCGGCCAAGGTACGGCCGTCCTCGAGCTGCTTGCCGGCGAAGATCAGCCTCTGCTGGTCCGGCGGGATCCCTTCCT
TGTCCTGGATCTTGGCCTTAACGTTGTCGATGGTGTCAGAGCTCTCCACCTCGAGGGTGATGGTCTTGCCGGTGAGGGTCTTGACGAAGATCTGCATCTG
TAGAGCACCAAAAAGAGATCACAAATTTAAGCCTCCCCTTCAACCATCGCAACCCAGAAATCAAGAAAACGCCAACAACACGAAACCCAGAAAACCCAAG
ATCCAAGATCAAAACGTATACGGAAAAAGAAGGAAACCCAATTCGCAGATCGCGAAGAACGGAGAGATCGGAGATCGGGAAGCCCTACCTTGAAAGAATT
CGCAAGGGGCTTGGCTGAGAATCAATCGAGAAGAAAGGAG