Detailed information on CNT30524487


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30697427Setaria italicaOryza sativa18.4421.6589.43246forward
CNT30677192Setaria italicaSetaria viridis43.6378.1297.25582forward
CNT30314796Setaria italicaCorylus avellana17.9234.7984.52239forward
CNT30518741Setaria italicaJuglans regia17.4746.9884.98233forward
CNT30702585Setaria italicaQuercus lobata6.939.8385.8792forward
CNT30273043Setaria italicaChenopodium quinoa25.5613.6682.4341forward
CNT30380779Setaria italicaManihot esculenta13.6429.2183.52182forward
CNT30405165Setaria italicaBeta vulgaris12.7432.4485.29170forward
CNT30200362Setaria italicaPisum sativum6.631.5484.0988forward
CNT30710572Setaria italicaGlycine max9.8229.3183.21131forward
CNT30297329Setaria italicaTriticum aestivum11.2464.3887.33150forward
CNT30223439Setaria italicaHordeum vulgare7.1222.7890.5395forward
CNT30390900Setaria italicaTriticum turgidum16.4231.6589.95219forward
CNT30586189Setaria italicaMusa acuminata12.3723.1187.27165forward
CNT30541563Setaria italicaBrassica napus12.9725.9480.35173forward
CNT30237332Setaria italicaBrassica oleracea8.5547.581.58114forward
CNT30258087Setaria italicaAvena sativa17.9251.0787.45239forward
CNT3075755Setaria italicaBrassica juncea12.9725.480.35173forward
CNT30263618Setaria italicaBrassica rapa16.7231.7278.48223forward
CNT30610790Setaria italicaGossypium raimondii17.2475.1685.22230forward
CNT30216367Setaria italicaKalanchoe fedtschenkoi12.8247.2485.38171forward
CNT30128108Setaria italicaCorymbia citriodora9.9725.4388.72133forward
CNT30348318Setaria italicaEragrostis tef17.9231.7891.21239forward
CNT30365623Setaria italicaSorghum bicolor16.8720.1692225forward
CNT30570332Setaria italicaVitis vinifera17.5439.281.62234forward
CNT3037127Setaria italicaCucumis melo10.7926.7280.56144forward
CNT30117905Setaria italicaOryza nivara18.4421.389.43246forward
CNT30604735Setaria italicaOryza punctata12.7420.1791.18170forward
CNT30334895Setaria italicaCynara cardunculus16.4954.0580.45220forward

Expression of CNT30524487

Peptides detected in this lncRNA

>peptide 1 (82 aa)
MACSAEERSMGQQQPQVRRELPAPLEVDLMLGRPRRRRQVQQEPRPELCQPLPELGRRLAGVRRHELPRQPLKELGRPAGVC*

>peptide 2 (87 aa)
MAHCLQCALEVGTRLLAARIVLVDVVLDEHSLLGLGGLAVGGVLAELRQGVGLGAEQQSILSRLHVLWPAAPCLEAGGILLRRSLRV*

>peptide 3 (91 aa)
MSFPDSRSKSSAALPAYADMSFSDSRAPIPAIIVLVLPSRARELSLSGISLTAVHPTKASRTSSPTAPNKSSSWGRKILHPVCFLLFFSFF*

Sequence

>CNT30524487
TTGTTTCTTGTAGTACTTGCTATATAATTCTTGTCACAGGACTGATTAGGCGTTGTTGAGGTCGACCGGGTCAAGCAGCTGCTCGCCATGGCGTGTTCTG
CCGAGGAACGCAGCATGGGACAGCAACAGCCACAGGTGCGTCGTGAGCTCCCCGCGCCCCTGGAGGTAGATCTTATGCTTGGCCGACCTCGTCGACGCCG
ACAGGTGCAGCAGGAACCCCGCCCAGAACTTTGCCAGCCGCTCCCAGAGCTCGGCCGCCGCCTTGCCGGCGTACGCCGACATGAGCTTCCCCGACAGCCG
CTCAAAGAGCTCGGCCGCCCTGCCGGCGTATGCTGACATGAGCTTCTCCGACAGCCGCGCGCCCATCCCGGCGATCATCGTGCTCGTGCTTCCGTCGCGC
GCGAGGGAGCTGAGCCTCTCGGGGATCTCCCTCACGGCTGTGCACCCGACCAAGGCGTCGCGGACCTCGTCGCCGACAGCGCCCAATAAGTCCAGTAGCT
GGGGTAGAAAAATCCTTCACCCTGTCTGTTTTCTTCTTTTCTTTTCCTTTTTTTGAGGCCATCACAATGGCTTGGATTATTATAAAAGTACTTTTACATC
CAGCCCCTTGCAAAAGGACCTCTGAAAGAAATTAAAATTACATTGAAGTCCTTTGGAGGTCCTCCTGTTTTCTGGAAATTGGGAATTTGCACTGCTCTTA
CTCGGGTCAAGCCTGAGCTATCAGACCAACACCTGTAGTACCAGCATACCACAGGCCACATAAGGTAGTAACCATGTGAATGTGAACCTGTAGTACCAGC
ATACCGAGGATAGTAAAATCGCAGTGTACTCTTTGTCCCGGCCCATCTGAACCTGTAATATGGCACACTGCCTACAGTGTGCCCTCGAGGTAGGTACTAG
GCTACTAGCAGCGCGTATCGTCTTAGTAGACGTAGTTCTTGACGAACATTCCCTCCTTGGCCTCGGCGGCCTCGCCGTCGGAGGTGTACTTGCCGAGCTG
CGCCAGGGAGTTGGCCTTGGCGCGGAGCAGCAGAGCATCCTGAGCCGCCTTCACGTTCTCTGGCCGGCCGCCCCATGTCTTGAGGCAGGAGGGATCCTTC
TGCGGAGGAGCTTGAGGGTGTAGTCGGCAACTTGCTGAGGGGTGGCCCTGTCCTTGCACTCAGCACCAGGGGTGACCATGCTGGGCTTGAGGAGGATGCC
CTCGAATATCACATTGTTCTCAGCCAGGTAGTAGAAGGTCTCGGCCCACACCTTCTGTGCAACCTCGAAGGTCCTCTCGATGCCGTGCTCACCGTCAAGA
AGGATTTCAGGCTCCACAATTGGCCCCAGGCAGC