Detailed information on CNT30524121


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30676610Setaria italicaSetaria viridis56.1368.599.71348forward
CNT3017870Setaria italicaZea mays36.4555.890.71226forward
CNT30339804Setaria italicaEragrostis tef62.137.0584.94385forward
CNT30365991Setaria italicaSorghum bicolor48.2398.3689.3299forward
CNT30603977Setaria italicaOryza punctata50.4877.8679.23313forward
CNT30558445Setaria italicaPanicum hallii95.3210093.91591forward

Expression of CNT30524121

Peptides detected in this lncRNA

>peptide 1 (42 aa)
MANAWPFGTGDRLLVLGAKRSSDTILPREQLVSLVEGSSLCK*

>peptide 2 (73 aa)
MQEEVGRNSEMMEEASKNCGLEEEVSKQQQLGEEVSKQRKREEEASKQQNLEEEVRDEVGSSNHPSFSLAISG*

>peptide 3 (43 aa)
MHGLLVQGIGSSFLEQRDLQIPFFHVNNWFHSLKVRRYANDVL*

>peptide 4 (38 aa)
MRWAPQTIHHSHWRSRAKPKFSRISIAHGECMAFWYRG*

>peptide 5 (30 aa)
MLQDMTCLSSFNILSESDGIFLPLPKATGSI

>peptide 6 (32 aa)
MQMMFSDTRHRNVKELLMVPWHATRHDMLVFI*

Sequence

>CNT30524121
TGTTAAACCCAAGGTAAACCTGGCCAAATGTACCACTGCCTAGCAATTTCCCTTTTTTCCATTGTGATTGGGACTGTGAGCAAGTAGTGGGAGATGCAGG
AAGAGGTGGGCAGGAACTCGGAGATGATGGAAGAGGCGAGCAAGAACTGTGGTTTGGAGGAAGAGGTGAGCAAGCAGCAGCAGCTGGGTGAAGAGGTGAG
CAAGCAGCGGAAGCGGGAGGAAGAGGCGAGCAAGCAGCAGAACCTGGAGGAAGAGGTAAGGGATGAGGTGGGCTCCTCAAACCATCCATCATTCTCACTG
GCGATCTCGGGCTAAACCCAAATTCTCTAGAATTTCCATTGCTCATGGCGAATGCATGGCCTTTTGGTACAGGGGATAGGCTCCTCGTTCTTGGAGCAAA
GAGATCTTCAGATACCATTCTTCCACGTGAACAACTGGTTTCACTCGTTGAAGGTTCGTCGCTATGCAAATGATGTTCTCTGACACTAGACACAGGAATG
TCAAAGAACTTCTGATGGTCCCGTGGCATGCTACAAGACATGACATGCTTGTCTTCATTTAACATTCTATCTGAATCAGATGGCATATTTCTTCCCCTAC
CAAAAGCAACAGGATCCATT