Detailed information on CNT30523789


BLAST search results

BLAST vs Swiss-Prot:
sp|Q01516|ALFC1_PEA, E-value = 3e-145

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30139084Setaria italicaLolium perenne25.2638.1988.44320forward
CNT3017013Setaria italicaZea mays27.7856.0594.89352forward

Expression of CNT30523789

Peptides detected in this lncRNA

>peptide 1 (34 aa)
MPCSPSSRISGSTIGTSPLSCSVDSIPSVLAFIN*

>peptide 2 (72 aa)
MALRFCVASTSDCPPERNMMPGTEGGMRRWRSFRVYSATCSGVARSLASAPGVTMDGLSRMPSNMTLFSAMA*

>peptide 3 (44 aa)
MPSLASAASPSEVYLPSCASELALARSSSASCAALTQVFCSARA*

>peptide 4 (28 aa)
MDASRFPHVAFDSSMARMPRPGDAIVFCN

Sequence

>CNT30523789
ACTCGATCGATCAACTTCATAATTTAATTTCTCTTATACATATAGTATAGCATTACCATGCCTCAAGCTTGCATCTCAATGGCGAGCTCGATCTTTGCAG
TAGCTAGCAGTAGTAACTAACGGCACGCACAAAGCATCGATGAGCACCATGCATGGATCATCACAGCGAAGACGTGCTTAGCTTGCGTAACCAGTATGTA
TCGTCGGAGTAGCTAGCCGATGAATTAGTAGCTGTAGTTCTTGACGAACATGCCCTCCTTGGCCTCGGCGGCCTCGCCGTCGGAGGTGTACTTGCCGAGC
TGCGCCAGCGAGTTGGCCTTGGCGCGCAGCAGCAGCGCGTCCTGCGCCGCCTTGACGCAGGTGTTCTGCAGCGCCCGCGCGTAGGAGAAGGACACGTGCC
ACGGGTTGGGCCCCTGGTTCATGGCGTTGAGGTTCTGCGTCGCCTCCACCTCCGACTGCCCGCCGGAGAGGAACATGATGCCGGGGACGGAGGGCGGGAT
GCGGCGGTGGAGGAGCTTCAGGGTGTACTCGGCGACCTGCTCCGGCGTGGCCCGGTCCTTAGCCTCGGCGCCCGGCGTCACCATGGATGGCTTGAGCAGG
ATGCCCTCGAACATGACGTTGTTCTCCGCCATGGCGTAGAAGGTCTCGGCCCACACCTTCTGCGCCACCTCGAAGGTCCGCTCGATGCCGTGCTCGCCGT
CCAGCAGGATCTCCGGCTCTACGATCGGCACAAGTCCGTTGTCCTGCTCGGTCGATTCCATTCCATCGGTGTTAGCTTTTATTAATTAGCTGGATGAACT
ATCTCCATGGCTAGAAGCAAGCAAGAAGGCGTACCTGCGAGATGGCGGCGTAGCGGGCGAGCCCCCATGCGGCCTCCTTGACGGCGAGCTCGGATGGCCC
GTTGGGGATGCTGACGACGGTGCGCCACTTGGCGAATCGGGCGCCCTGCTGGTAGTAGGCGGCCTCGCGGGCGGCGAGGCCGTCGAGGCCCTTGTCGACC
TTGATCCCGGGCACGATGCCCTGCTCGGTGAGGATGTCGACGATCCGGCGGCCGTCGACGGCGGACTGGTAGAGCGTCTCCTCGAAAAGGATGGCGCCGG
AGATGTAGTTGCCCAGCCCCGGCGCGGTGACCAGCAGCGTCCTGTACGCCTGCCGGTTGGCCTCCGTGTTCTCCAGCCCGATGGATGCCAGCCGCTTCCC
GCACGTCGCGTTCGACTCGTCCATGGCCAGGATGCCGCGCCCAGGCGACGCGATCGTTTTCTGCAAC