Detailed information on CNT30523690


BLAST search results

BLAST vs Swiss-Prot:
sp|Q7M258|FER2_PEA, E-value = 5e-10

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30675769Setaria italicaSetaria viridis52.0262.22100387forward
CNT30442558Setaria italicaAegilops tauschii32.2645.6387.5240forward
CNT30669087Setaria italicaTriticum dicoccoides31.4545.5390.17234forward
CNT30596694Setaria italicaOryza meridionalis33.7429.8586.85251forward

Expression of CNT30523690

Peptides detected in this lncRNA

>peptide 1 (29 aa)
MHDTRKGIVRRRQTRSLARARQILDIASA*

>peptide 2 (41 aa)
CTKIKRKNVINYLSEAYHASAVKMNDTETSNKQSNKRWRSC*

Sequence

>CNT30523690
TTGTACAAAAATAAAGAGGAAAAACGTTATTAATTACTTGAGCGAAGCCTATCATGCATCCGCAGTAAAAATGAATGATACAGAGACCAGCAATAAGCAG
AGTAACAAACGATGGAGAAGCTGCTGATGCCGATGCTTAATTGCAAGGTCTCATGGTGACACTGACATGCATGATACAAGAAAGGGAATTGTCCGGCGTC
GTCAAACTCGATCTCTTGCAAGAGCAAGACAGATACTAGATATAGCAAGCGCGTAGCAGGTAGTGATCGAGCTTCTTAGATGAGCTCCTCCTCCTTGTGC
GTCTCGATGACGACGTCGGAGGTGGGGTAGGCGTGGCAGGTGAGCACCCACCCGGCGGCGACCTGGCCGTCGTCGAGGAAGCTCTGGAGCAGGAGCCGGC
GCGGCACGAGTAGGGCAGGTCGATCCCATCCTCCTCGGCCTGGTCGAGGATGTAGACGTCGTCGGGCACCTGGAGCTCCACCTCGCCGTCGGGGGTGATG
AGCTTGACGTTGTAGGTGGCCTGCGCGCGCAGCCTGGCGCCGCGGGCGACCTTGGCCGGCAGCGCGACGGTGGCCGGCGCCGGCGCCGGGGCGGCGCGGA
CGGAGAAGGCCGGCGCGCGGAGGCTGCTGAGGGCGGTGGCCATTATTGTGCTTTGTGGTTGCTAGGTAGCTGCAGCAGCTGAAGCAATGGAAGAATCGGC
CACACACACCTAGGGATTAGGGAAGGAATGAAGGAGCAATGGAG