Detailed information on CNT30523068


BLAST search results

BLAST vs Swiss-Prot:
sp|Q56YU0|AL2C4_ARATH, E-value = 5e-70

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT305817Setaria italicaZea mays28.645.9794.16137forward
CNT30363804Setaria italicaSorghum bicolor46.9773.7794.67225forward

Expression of CNT30523068

Peptides detected in this lncRNA

>peptide 1 (33 aa)
MWPTTPTGSLSVYPCIRCAILSVSPWILSAAPA*

>peptide 2 (74 aa)
SRDTDLRLLSAAAFMTRRPTSVDPVKLSLSTSMCDATAAPAVGPNPVTTLRTPSGTPASLARAGLTLKKNMVVG*

Sequence

>CNT30523068
CTCGAGGGACACTGACTTGAGATTGCTTTCGGCGGCCGCCTTCATGACGAGGCGACCGACCTCCGTGGACCCGGTGAAGCTGAGCTTGTCGACGTCCATG
TGCGATGCGACGGCGGCACCGGCGGTGGGCCCGAACCCGGTCACGACGTTGAGGACGCCGTCGGGGACCCCTGCCTCCTTGGCGAGGGCCGGGCTGACCT
TGAAGAAGAACATGGTGGTGGGGTAGTTCCAGGGCACGATGTGGCCGACGACGCCGACGGGCTCCTTGAGCGTGTACCCGTGCATCCGCTGCGCCATCTT
GAGCGTCTCGCCGTGGATCTTGTCGGCGGCGCCGGCGTAGTAGCGCAGCAGGTGCGCCGCGCCGGGGATGTCCCGTACCTTGCCGACGAGGAAGAGCTTG
CCGGCGTCCACCGTGTCCAGCATCGCCAGCTCCTCCACGTGCTGATCGATCAGGTCTGCGAACTTGTGCAGGATCCGGC