Detailed information on CNT30522970


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30522970

Peptides detected in this lncRNA

>peptide 1 (88 aa)
MVLPGEKTQEIPSQAHSQAHFITPTSITLRHLLNSHAEIHGLQEVDLIQLLVREVPEQQVLVVVQAEGRIGNIQGVQAGAEVHRVDVG*

>peptide 2 (41 aa)
MFFAWEAEISLGTSRWCCPGKKPKKSPPKRTHRPILSHQHR*

>peptide 3 (36 aa)
MSICWWFNGAISLLSLAPERTPKLVAKISKTEGEKL*

Sequence

>CNT30522970
CAGCTCAATGACTTGTCCACTATAATGTCTTGACAAGCATTACCAAATGACACTGGAAACATGACAGTACCACTACTATAACTTACCATAATGTAACCTA
CCAAAATTACCTCTCCAAACGCTAATGTTCTTCGCTTGGGAAGCAGAGATTTCCTTGGGCACGAGCAGATGGTGTTGCCCGGGGAAAAAACCCAAGAAAT
CCCCTCCCAAGCGCACTCACAGGCCCATTTTATCACACCAACATCGATAACACTAAGGCACTTGCTTAATTCACACGCAGAAATCCACGGTTTGCAGGAA
GTCGATCTCATCCAGCTCCTCGTCCGCGAAGTCCCCGAACAGCAGGTCCTGGTCGTCGTCCAAGCAGAAGGGCGCATCGGAAACATCCAGGGCGTCCAGG
CCGGCGCGGAAGTCCATCGGGTCGATGTCGGGTAGCTGCAGCCCGCGCAGAAGGTCCTGGTAGAACTCCGGGTCGTCCGGCAGCTGCGCAGCTTCAGTGG
ACGGCAGGATAGGTGTTGCAACCGGCTCCGGCGACTCAGCCTTCAGTGCAGGCTTGGTGGCTTCGAGCACGGAGGACGGCGACGGGTGGGCGAACGGAGC
AGCCGAGGTGGACGACGAAGAGGAGTCCGAGTCCGTCGCGTCAGGGTCCTCAAACAGGACGCGGACGCGGCGCCTCGGCTGGACAGGCGCCGGCGGCTGC
ATCTGCGGCCTGGCCTTGAGGAGAGCAGCGGAGGGTTTAAGGCCAAATCCTGAGATCCTCTTGGTCTTGGGCTTCTTCGCCAGGGCCTTCTTGATGAGCA
TCTGCTGGTGGTTCAACGGAGCCATCTCTCTTCTATCTCTTGCGCCGGAGAGGACTCCAAAACTTGTGGCCAAAATTTCCAAAACTGAAGGGGAAAAACT
CTAAAAAAAG