Detailed information on CNT30522431


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30466486Setaria italicaSaccharum spontaneum24.9649.7280.23177forward

Expression of CNT30522431

Peptides detected in this lncRNA

>peptide 1 (33 aa)
MESDLMIGRKMPPALAAVLGMAGAMQASPRVSP*

>peptide 2 (64 aa)
MVERKMESICHALGLTSAGRGARNRTARPTAMEMTSGTSFAPEAAGGSGLGLGEAAGGHGEAWD*

Sequence

>CNT30522431
GCGTCATCACAAGATATGATCCGAGCTTCCGTGAAGATGGATGATTGGGCTTGCTGCCAGCCGAGATGGAGAGTGACTTGATGATCGGCAGGAAAATGCC
CCCTGCCCTCGCCGCGGTGCTGGGCATGGCCGGCGCTATGCAGGCCTCGCCGAGGGTGAGCCCGTAGGACAGCCCCAGCGTGCTGCTCCCGAGCCACTTG
ACGAAGTAGGTGGCGATGCGGCGGCGAAGGGGAGCGTTTTCGTGGCAACGACGGTCGTGAGCCCGAGGAAGGCCACGGCGCCGACGGGGAGCGGGCCCAG
CACGAGCCCCGCGATGGTGGAGAGGAAGATGGAGAGCATCTGCCACGCGTTGGGGCTCACCTCGGCGGGCCGCGGCGCGAGGAACCGCACGGCGAGGCCG
ACCGCGATGGAGATGACGAGCGGCACAAGCTTCGCACCGGAGGCGGCGGGGGGCTCTGGTTTGGGGCTCGGAGAGGCTGCAGGAGGTCATGGCGAGGCGT
GGGACTGAGGCGTTGATGGTGCGGGGAGAACAGGGAGGGGGAGGTGCGGGGGAGGGAGATTAGGCCGGGAAGGTGGCGGCGGCGGAGGTAGGCCGGCGCC
GGTACCGCCGCCACCGGGAGAGACGGCCGGTGAGCGACGACGAGGCCGATCTCCATCGGTGGCAGCGGAAAGTGTGTGGCGGAGTGGGCAGTGGGCGGGA
GGCGGGCGG