Detailed information on CNT30521859


BLAST search results

BLAST vs Swiss-Prot:
sp|Q10HD0|CB23_ORYSJ, E-value = 2e-146

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30298671Setaria italicaTriticum aestivum56.3368.3787.79467forward
CNT30556099Setaria italicaOryza glaberrima73.4662.4692.94609forward
CNT30664531Setaria italicaTriticum dicoccoides73.5888.5389.51610forward
CNT30103254Setaria italicaOryza rufipogon67.6744.8187.17561forward
CNT30575846Setaria italicaOryza barthii69.8465.592.75579forward
CNT30116728Setaria italicaOryza nivara71.2966.8692.72591forward

Expression of CNT30521859

Peptides detected in this lncRNA

>peptide 1 (38 aa)
MGPLPVTMACTKNPNMENMARRPFLSSFTLSSAAAPPG*

>peptide 2 (29 aa)
MAHREWITSSSRLRAKVSGSAESPAVSHP*

Sequence

>CNT30521859
TGACGGTTCACTCACGAATGGTACACCGTTGCATTGATTCATCATCAGCTGACATACGCATCTGTGCTTAGTTTACAATAATTTTACATCGTCGGGCACG
TCCAGGCAGCTGCTAGCTGGTCTGGTCTGGTCTGATCTGAAGAGCTCACGAGCACAAAGCAATACGCTGGCGCGTGCAACTACTACACGCCTACTCACGA
GCAGAGGGCACATCACTTGCCGGGGACGAAGTTGGTGGCGTACGCCCATGCGTTGTTGGCGACGGGGTCGGCGACGTGGTCGAAGAGGTTCTCGATGGGT
CCCTTGCCGGTGACGATGGCCTGCACGAAGAACCCGAACATGGAGAACATGGCGAGGCGGCCGTTCTTGAGCTCCTTCACCTTGAGCTCGGCGGCGGCGC
CGCCGGGGTAGACCTTGTCGAGTCCCTCCCCGAGCGGGCCGCCGCCGACGCGGTAGCCCTCGACGAAGCCCATGAGCACGACCTGGCAGGCCCAGATGGC
CAGGATGCTCTGCGCGTGCACCAGGTTGGGGTTGCCCAGGTAGTCCAGCCCGCCCTCGGAGAAGATCTGCGCGCCGGCCTTGAACCACACCGCCTCGCCG
AACTTGACGCCGTTCTTGGCAAGGATCTCCGGGAACACGCACCCCAGCGCGCCGAGCATGGCCCACCGCGAGTGGATCACCTCCAGCTCGCGGTTGCGCG
CGAAGGTCTCCGGGTCGGCGGAGAGCCCCGCGGTGTCCCACCCGTAGTCGCCGGGGAACTCGCCGGTCAGGTACGACGGCGTCTGCTCCGAGAACGGGCC
CAGGTACTTGGGGCGGTCAGGGCCGTACC