Detailed information on CNT30521815


BLAST search results

BLAST vs Swiss-Prot:
sp|P36213|PSAD_HORVU, E-value = 1e-59

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30446699Setaria italicaSaccharum spontaneum53.5129.7797.38267forward

Expression of CNT30521815

Peptides detected in this lncRNA

>peptide 1 (38 aa)
DHQENLIIVIKLHIDRPSINHPTPAKRKRWMRSLRCRS*

>peptide 2 (54 aa)
MSKLILYLERSLVPSARHCSLRASFRRLGPSRMMAAPPVGISNTCSLGDVHVIT*

Sequence

>CNT30521815
CGATCACCAAGAAAACCTGATTATAGTAATAAAATTACATATCGATCGACCCTCCATCAACCACCCAACACCAGCTAAGAGAAAGAGATGGATGAGATCA
CTTAGATGTCGAAGTTGATCTTGTACTTGGAGCGCAGCCTGGTGCCGAGCGCCAGGCACTGCTCCTTGCGCGCCAGCTTCAGGAGGTTGGGCCCCTCCCG
CATGATGGCGGCGCCGCCCGTCGGCATCTCGAACACCTGCTCCTTGGGGGACGTCCACGTGATCACGTAGAACTCCTCCACCTGCGCCTTCCGGAGCAGC
CCGCCCGTGCTGCCGCCGAAGATCGGGGACGGGGTGTTGGGGTCAAGCTGCGGGGGCACGAACCCCTTGGGCGCCTCCTGGGTCGCCGCCGCGGGGGCCT
CCTCGGCGGCCGCGCGGAGCGGGGCCGGCCCGCGGGAGGACGACGGGAGCGCGAGCTGCGAGGACCGCGGCGCCTTCGCCGCTGGCGACCAGGCCGCGG