Detailed information on CNT30521542


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30521542

Peptides detected in this lncRNA

>peptide 1 (33 aa)
MLIRQKFGEDVVPATGGMAMLSTCGSNGGARSK*

>peptide 2 (76 aa)
HLVCRRSVLCSILSPSLLQAGPPSCCTNRRARSQRDFTSNSKKFDWWNNKDLDSGCKISIWVATTSILAARSRLGS*

Sequence

>CNT30521542
CATCTAGTCTGTCGCCGCTCCGTCCTCTGTTCTATCCTTTCCCCTTCTCTCCTCCAAGCTGGTCCGCCTAGCTGCTGCACAAATCGAAGAGCTCGATCTC
AGCGGGACTTTACATCCAATAGCAAGAAGTTCGATTGGTGGAACAACAAGGACCTCGATTCCGGCTGCAAGATTTCGATTTGGGTGGCTACAACCTCGAT
TCTTGCTGCAAGATCTCGATTAGGATCGTGAGGATTTCTATTTTGCGGTTTCCTCGTCATTGCGTCCAGTCAAGGTCACCATGGTGGGACATCGAGCTGG
GAGGGTGTGACAGCAGGTGTTGTGAATACGATGGTGATGGTGTATCCTTCAAGGTCCTCTTGTCGGAGCAAAGAATCTTCCCCATGACAAATCTAGTTTG
AAGGAATGTTGATCCGACAGAAATTTGGCGAGGATGTGGTACCTGCAACCGGCGGCATGGCCATGCTTAGTACTTGTGGAAGTAATGGCGGTGCCCGATC
CAAGTAGTTGTCTTCGTTGATAGGTGTAATGTGATTTGACTGAGATGCCATTGTTGTTGTGTGGGAGATGAGGAAGATGCAAATCTGATAATTATCTTTT
TGTGTTTTTAGTGTTGTTAGCTTGGCGGCCGATAAAAACTGCACCCGCTGTAATTGGCGCCATTTTCTTCAGAATTAGGTGGCTTTTCCCTCCA