Detailed information on CNT30521184


BLAST search results

BLAST vs Swiss-Prot:
sp|P31155|METK1_PETCR, E-value = 2e-79

BLAST vs NONCODE:
NONPOPT000585, E-value = 1e-53

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30672532Setaria italicaSetaria viridis25.8462.0799.66594forward
CNT30549537Setaria italicaIpomoea triloba19.1866.2281.63441forward
CNT30266729Setaria italicaChenopodium quinoa19.434.683.41446forward
CNT30650282Setaria italicaRosa chinensis18.1435.485.85417forward
CNT30367696Setaria italicaSorghum bicolor27.473.2692.54630forward
CNT30432398Setaria italicaPapaver somniferum18.7935.5881.71432forward
CNT30101941Setaria italicaOryza rufipogon18.7951.7491.67432forward
CNT30496713Setaria italicaDigitaria exilis25.3238.6592.1582forward

Expression of CNT30521184

Peptides detected in this lncRNA

>peptide 1 (32 aa)
MRKTRARKPIIRGTKQPGKPLPARRIKNPPGS*

>peptide 2 (31 aa)
MFSYRQYGRKNRSGKVKITATKQIRDQQSRD*

>peptide 3 (51 aa)
MAFQGVHFIRPRGEPFLFPPLEHDKNSTSDKNHSLPVPNRRVRKRPPPPNL*

>peptide 4 (62 aa)
MIDMLIYIRPITNQFVEMFINHTDRTIWILSKHSTSFRPGYFTEICPIVSCSIRKYKKETLV*

>peptide 5 (38 aa)
MIARGRSRITTQKPQNMISAADQKLLLKGRLRQKASPT*

>peptide 6 (42 aa)
MMIMPGLKSKFSLIILRISLSGIVPVPYVSTNTERGSGTPMA*

>peptide 7 (70 aa)
MARNAQDARAQAYHPRHEATRQTIASAADQEPPWLLENKILVQNKRKTLRRANPTELRAERRTDGERGGDG

>peptide 8 (93 aa)
MVKARPSSSKFLTACRKKTPQKPHSSMCMLPIKKCFEHGDLLVDRHKTKLTKSQILFPNHFIRRCKISITIISAATFTVYSKNLSSSPPVFTA*

Sequence

>CNT30521184
CACGCATGACAAGATAGAAAGCAGCAGGTCCCCTTCCTTCTCAAAGTAGCCTGCAGCTTCATTCTTTGGTTCACCATTACATAAACAGCAAAACCAGAAA
TAGCAGACAATAATTCCTCCTCTAGGTAAATAACCAGACACAGTAATACCCTCACAAGTACCACTTATTAGGACAGTACAATACAAATGATAGCAAGGGG
CAGATCAAGAATCACAACACAGAAGCCACAAAACATGATAAGCGCAGCAGACCAAAAGCTTCTTCTCAAAGGGCGCCTTAGGCAGAAGGCTTCTCCCACT
TGAGGGGCTTCACCACCTCCCAGGTGAAGTCAGGGTCGTCCCTTCCGAAGTGACCGTAGGCAGCTGTCTTGAGGTAGCGCCCGTTGCCGCCTTTCTTGAG
GTCAAGGTTGATGATGATCATGCCAGGCCTGAAGTCGAAGTTCTCCTTAATAATCTTGAGGATCTCCTTGTCGGGGATCGTGCCAGTGCCATATGTGTCA
ACAAACACGGAGAGGGGCTCAGGCACACCGATGGCATAGGAGACCTGGACGATGGCGCGGCGAGCAAGGCCATTAGCGACAATGCTCTTGGCAGCTTGCC
TGGCAATGTAGGCTCCACTGCGGTCAACCTTGGTTGGGTCCTTGCCGGAGAAAGCGCCACCACCGTGGGCTCCCCAGCCACCATAGGTGTCAATGATGAT
CTTCCGGCCAGTGAGACCAGCATCACCATGAGGTGAAGAGGAAGGTGTCGACTGCGGCCATCTTTTCTGATCTGCAGCAGGCAATACAAATGTTTAGTTA
CAGACAATATGGTAGAAAAAATCGCTCAGGCAAAGTAAAAATTACTGCAACCAAACAAATTCGTGATCAACAAAGCAGAGATTGATATGATTGATATGCT
CATATACATAAGACCAATAACTAATCAATTTGTTGAAATGTTTATAAATCACACTGACAGGACAATCTGGATTCTTAGCAAACACAGTACTTCTTTTAGG
CCAGGATACTTTACCGAAATTTGTCCTATTGTCTCATGCAGTATAAGGAAATATAAAAAAGAAACATTAGTCTAATAAACAAGCAACAAAAAGGGCATCT
TTGTATCTTATGGCCATGAAAACCTTCTGTTTTGCTGGCACATAACAAGACCACACACTCCAGGCTGAGAGATTCGTCATGCTCTAAATTCCTCCAATAA
AAAGTTTGGCATTTCTGATCTGCTGGCACAAGAGTATGGTCCATATGTGTGGCTAGTGGATGCAAGGCACAAGGAATCTACCAAGTCTCAGCCGAATCAC
CATAAGAATAAGTATGGTCCATATGTGTGGCTAGTGGATGCAAGGCACAAGGAATCTACCAAGTCTCGGCCGAATCAGCATAAGAATAAAAAATCGCCCA
ATGAGATCCTAGGAACAAAATAACCACTCAAATATGCTTCCACTACCTACTGTAAGGCAAAAAGGTAATATTTATGAAGCAACACATCACGGGACATGGT
AAAAGCAAGACCCAGTAGCTCCAAATTTTTAACTGCTTGCAGAAAGAAAACCCCTCAGAAACCCCATAGCAGCATGTGCATGTTGCCTATCAAAAAGTGC
TTTGAGCATGGGGATTTGCTTGTAGATCGTCATAAGACAAAACTAACCAAAAGTCAGATTCTTTTTCCTAACCATTTTATTAGGAGATGTAAAATCAGCA
TCACTATCATTTCAGCAGCAACCTTTACAGTATACAGTAAAAACCTAAGCAGTTCTCCACCAGTTTTTACCGCATAAACAAAGATTAAAGCATGCTGACA
CGGAAGCACAAACTTTTCCTAAACATGCATGGCATTCCAAGGAGTCCATTTCATCCGACCACGTGGTGAACCTTTCCTCTTCCCTCCTCTAGAACACGAC
AAGAATTCTACGAGTGACAAGAACCATTCACTACCCGTTCCAAACAGGCGGGTACGAAAGAGACCCCCCCCCCCCAATCTCTAGCTATAGGATTATAGCA
AAAGAAAAAGGAAACATTTCGCGGTACATATAACAGAAAAAAAAAACGCAAAAGCTGTTATGGGAGCACCAATCTTGTACGCTGATGGCTAGAAATGCGC
AAGACGCGCGCGCGCAAGCCTATCATCCGAGGCACGAAGCAACCAGGCAAACCATTGCCAGCGCGGCGGATCAAGAACCCCCCTGGCTCCTAGAAAACAA
GATACTAGTACAAAACAAAAGGAAAACCCTACGGCGGGCAAACCCCACCGAACTCAGAGCAGAGCGGCGGACCGACGGCGAGAGAGGCGGGGACGGAGG