Detailed information on CNT30521132


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30672689Setaria italicaSetaria viridis44.853.1299.67306forward
CNT30553839Setaria italicaOryza glaberrima17.4221.6889.92119forward
CNT30101786Setaria italicaOryza rufipogon16.5420.7391.15113forward
CNT30116861Setaria italicaOryza nivara17.4221.6889.92119forward

Expression of CNT30521132

Peptides detected in this lncRNA

>peptide 1 (68 aa)
MRRTCSFIGGRRTLEKLVGIHGGGGRVPRIYKGGSGQLEFEKPKGAVCKSFFREEETTLKEKKLRGPE*

>peptide 2 (95 aa)
TLLSSRSKVAMRVCTCAFSAWRRATSATSSSSRCCFRARDRRADSLLDSIRLRLRSSAANPPPALPLSVLLSGLGSKEGLFLEGRGGKKIKDSRN*

>peptide 3 (99 aa)
HLAELAVEGRDAGLHLRVLGLEAGHLGDQLLQPLLLPRAGPARGLPVGQHPLALALVGGEPAAGAAAVGVAVRARLKGGTFFGRKGREKNQRFKKLREI*

>peptide 4 (32 aa)
MRRRRTSTGRRRRRSGNGGCGGRAASSEDDGR*

Sequence

>CNT30521132
CCACCTTGCTGAGCTCGCGGTCGAAGGTCGCGATGCGGGTCTGCACCTGCGCGTTCTCGGCCTGGAGGCGGGCCACCTCGGCGACCAGCTCCTCCAGCCG
CTGCTGCTTCCGCGCGCGGGACCGGCGCGCGGACTCCCTGTTGGACAGCATCCGCTTGCGCTTGCGCTCGTCGGCGGCGAACCCGCCGCCGGCGCTGCCG
CTGTCGGTGTTGCTGTCAGGGCTCGGCTCAAAGGAGGGACTTTTTTTGGAAGGAAGGGGCGGGAAAAAAATCAAAGATTCAAGAAACTAAGGGAGATCTA
ACAACCTAGAGAACGGAAGAGATGCTGGCGTTCTTGAGGGGGGCGATGCGTTCATGAGAAGACGTAGAACCAGTACAGGAAGGCGACGGAGAAGGAGTGG
GAACGGCGGATGCGGAGGACGTGCAGCTTCATCGGAGGACGACGGACGTTAGAGAAACTGGTGGGTATACATGGGGGCGGCGGCAGGGTTCCCCGGATCT
ACAAAGGAGGGAGCGGCCAACTAGAATTCGAAAAACCTAAGGGGGCTGTCTGCAAGAGTTTCTTCAGGGAGGAGGAGACGACTCTGAAGGAGAAGAAACT
ACGAGGACCTGAGTGAAAGAAAAGAAAGGGAGCAGGGACTTAGCTCAAAGAGAAGAAGGCCTGGGCGACCGGGGGCTCTATTG