Detailed information on CNT30520592


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONZMAT003838, E-value = 4e-75

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30394727Setaria italicaTriticum turgidum48.1513.2684.62299forward
CNT30554834Setaria italicaOryza glaberrima55.7211.3484.39346forward
CNT30450881Setaria italicaSaccharum spontaneum72.1441.2585.94448forward
CNT304455Setaria italicaZea mays17.3937.6387.96108forward
CNT30117540Setaria italicaOryza nivara36.7139.5187.28228forward

Expression of CNT30520592

Peptides detected in this lncRNA

>peptide 1 (77 aa)
MCTATVSGRKLSMSQLRSYRFLPLPARLSHLPTMRSSGPRVSLRARISSAPATQLATSHDTTYPMPCMNGMGWPPMA*

>peptide 2 (31 aa)
LPHYSPMVHFVSRTTCARTLTKQLTIDTDRK*

Sequence

>CNT30520592
CTCCCCCACTACTCTCCCATGGTCCATTTCGTGTCTCGCACAACTTGTGCACGAACACTTACAAAACAATTAACAATTGACACGGATCGCAAATGAATTT
GACACAAAAAAAAACGAAGTGTTGCTGGTCGATCGATCATGGCAGCTGGTGGTAGAGGTCGGACGGCTCGATCCCGGCGGTGACGTTGAAGTACCTGAAC
GCCGCCGCCCAGCGGTAGTTGTCCTTGAGCATGTGCACGGCGACGGTGTCCGGCCGGAAGTTGTCCATGTCCCAGTTGAGGTCGTACCGGTTCCTCCCCC
TCCCGGCGAGGTTGAGCCACTTGCCGACCATGAGGTCCTCGGGCCCCAGGGTGTCGTTGCGCGCCAGGATCTCGTCGGCGCCGGCGACCCAGCTCGCGAC
GTCCCACGACACGACGTACCCCATGCCGTGCATGAACGGCATGGGCTGGCCGCCCATGGCGTAGCCATAGCCCAGGTACACGTCGTCGCGGGGCTTGCCC
CGGAGCTCGTCGGCGAGCTCCGCCACCCGCAGGTACGTGTCGTCGTCGGTCTTCATCACGTAGTCGTAGGGGCGCGACGCGAAGAGGCGCGGCACGGAGG
AGAGGTACGCGTACGTCTTGC