Detailed information on CNT30520579


BLAST search results

BLAST vs Swiss-Prot:
sp|Q9S7M0|CB3_ARATH, E-value = 2e-128

BLAST vs NONCODE:
NONBNAT003428, E-value = 2e-26

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30671892Setaria italicaSetaria viridis42.2595.72100447forward
CNT30243592Setaria italicaAvena sativa50.1968.6987.95531forward
CNT30454234Setaria italicaSaccharum spontaneum31.2944.7397.58331forward
CNT30132148Setaria italicaLolium perenne34.0340.2290360forward
CNT3013298Setaria italicaZea mays50.3861.7696.62533forward
CNT30362471Setaria italicaSorghum bicolor20.4248.8797.22216forward
CNT30370632Setaria italicaOryza glumipatula22.9731.5694.24243forward
CNT3035078Setaria italicaCucumis melo37.6241.7282.91398forward
CNT30148203Setaria italicaBrachypodium distachyon40.4572.5488.79428forward
CNT30581304Setaria italicaEchinochloa crusgalli47.6453.995.44504forward
CNT30496441Setaria italicaDigitaria exilis55.5872.3292.86588forward
CNT30604338Setaria italicaOryza punctata34.9754.7392.97370forward
CNT30556551Setaria italicaPanicum hallii40.2672.296.95426forward

Expression of CNT30520579

Peptides detected in this lncRNA

>peptide 1 (36 aa)
KCKEAATCIDRKSAVQHIICFRSTQATTDREHNAHS*

>peptide 2 (61 aa)
MQPSAPSIAHRPWITSSALLRANASGSAESPAVYLTRSGPYHRSLLCKQQGLVRQHLSKLD*

>peptide 3 (61 aa)
MVIRPLAAAATSRRGLALAAARPWPRNSVLAARTREVAAAMIDAIPRSLLLCCGGTALRGCQ

>peptide 4 (35 aa)
MVAGTKQPSSFLRPGRCLRRGRRGGRAGSRGAPCR*

>peptide 5 (44 aa)
MACTKNPNMENMARRPFLISLTLSSAKVTGSSARPSGSKYWPPG*

>peptide 6 (31 aa)
MRKPSTRPMRMTWKPSTARMLCACTRLGLPR*

Sequence

>CNT30520579
TGAAATGCAAAGAGGCAGCTACATGTATAGATCGTAAATCAGCAGTTCAGCACATCATCTGTTTCAGGAGCACACAAGCCACAACTGACAGAGAGCATAA
TGCACATTCCTGAATCCTGAGAACAAGGTATTTGCATTAATTGGTGGTACAAAAGTAACGAGTAGTCTACAATGGTGGCAGGCACGAAGCAGCCGTCTAG
CTTCTTAAGACCCGGGCGTTGTTTGCGACGGGGTCGTCGAGGTGGTCGAGCAGGTTCTCGAGGGGCCCCTTGCCGGTGACGATGGCCTGCACGAAGAATC
CGAACATGGAGAACATGGCGAGGCGTCCGTTCTTGATCTCCTTGACCTTGAGCTCGGCGAAGGTGACGGGGTCGTCGGCGAGGCCGAGCGGGTCGAAGTA
CTGGCCGCCCGGGTAGAGGTTGTTGCCCTCGCCGACGCCGTCGAGGCCGTTGATGCGGAAGCCCTCGACGAGGCCCATGAGGATGACCTGGAAGCCCAGC
ACGGCGAGGATGCTCTGCGCGTGCACCAGGTTGGGGTTGCCCAGGTAGTCCAGCCCGCCCTCGGAGAAGATCTGCGCGCCGGCCTTGAACCACACGGGCT
CCTTGAAGTCCACGCGCACCCACTTCTCGAGCACCTCGGGCGTGATGCAGCCCAGCGCGCCCAGCATCGCCCACCGCCCGTGGATCACCTCCAGCGCCCT
GTTGCGGGCGAACGCCTCCGGGTCGGCGGAGAGCCCCGCCGTGTACTTGACGCGGTCCGGGCCGTACCACAGGTCGTTGCTCTGCAAACAACAAGGACTT
GTTCGTCAGCACCTAAGCAAGCTGGACTGATGCTGTAGGCGGGTGGTTTTGGCACCAAAGGGGTACGTACCATGGTGATCCGGCCGCTGGCGGCTGCGGC
GACGTCGCGGAGGGGGCTGGCATTGGCGGCGGCGCGGCCCTGGCCGAGGAACAGCGTCTTGGCGGCGAGGACGCGGGAGGTGGCGGCGGCCATGATCGAT
GCCATCCCTCGTAGCTTGCTGCTCTGCTGCGGCGGCACTGCACTGCGGGGGTGTCAAG