Detailed information on CNT30519847


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30348995Setaria italicaEragrostis tef14.2620.9685.06174reverse complement
CNT30364455Setaria italicaSorghum bicolor13.7722.6785.12168forward

Expression of CNT30519847

Peptides detected in this lncRNA

>peptide 1 (40 aa)
IQMELASPLPIELRQFIEVNHPRMKAGIQYTDIHHIQIYH*

Sequence

>CNT30519847
AATCCAAATGGAACTAGCCTCCCCCCTCCCAATAGAGTTAAGGCAATTCATCGAAGTTAACCATCCCCGAATGAAGGCAGGAATCCAATACACAGATATT
CATCATATCCAAATTTACCACTGACACGACATTCATCATATCTAAATTTACCACTGACACGACATTCATCATATCTAAATTTACCACTGACACGATATTC
ATCATATCTAAATTTACCACTCACATATATCACAGCTAAACTGACAGATACACAAACTTAGTTCAGGACTCTAGAACAAAAACTCACACGAATCAAACGC
ACGCCACACCCTTCGATTATTGCAACGAAAACCTAACCTGAATCATACTCAGGTCATCAACTAGCAGATCACCTAAACCAACAAATTCACATGCTAATTT
ACCCAACTCATGAACCAAACACCACCACCTAGAACCACCAGCCTGCAGACTTACTACTCTTAATCCACCAACACGCCTTGCTCTTAGTTATTCTACCTAA
AGACATCAGCTTTCCAGAGAAGAGAATCGAACCGAGCTGCAAGCGACTTGAGAACCTAACCACCACCAAATCCAACCACCGGTTGCTCGTCCATCAACCT
TTCCTCTGAAAAAATACCGGAAGAGGTTGATCGAAACGGCTACCGGGAGATCTGATCTGATCCGGAGATGCTTTCCGTCGGATCCAACCGCCCATCAGGC
GCTAACCATCCATAGATCCATCCATCCCGTAGGTCGGGAACAACCGGAGAAGAGGAAGACGAGAAGAGGCGACGACTTCAGAGGAGCGGACGCTGGTCCG
GCCGTGGCCTGTGGGGGCCGTGTGGTGGGAGCTCGCCTGCGTCAGGCGAGCTCACCGATGCGGAGGAGGCAGCGGAGGAAGAACGCCGGCATGGGGAGCG
AGCTCGGCTCGGGAGCCGCGGCGGAGAACGCCGGGCCCGCGTAGCGGGCCGCGTCGGGGGCGGAGGCGGCGGACACGATCTTCTTCGTCGGCACGACGGT
GGGCGCCTGCGGCCCGATCCGGCCAGTGGAGCAGGGGACGCGCTTGTCCACCGCTGCCGCGGCTTTCGCCACGGGCGCTGCTACGACCGGCGCCGGCGCT
GGGGTTGGGGCCGGAGCAGGGGGCTCCTCGCCGCGCTTGAGGATCCGGACCTCCTCCATAACAAGCCGCTGCTTCGGCTTCTCCTTCGTCGGGGACGGCT
GCTTCCGCGCCGCCGGCGAG