Detailed information on CNT30518418


BLAST search results

BLAST vs Swiss-Prot:
sp|P10978|POLX_TOBAC, E-value = 1e-28

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30379963Juglans regiaManihot esculenta3.6188.6787.78180forward
CNT30507162Juglans regiaNicotiana attenuata1.6137.918580forward

Expression of CNT30518418

Peptides detected in this lncRNA

>peptide 1 (30 aa)
MLLLICVNQHSQQNQNLSSQSLPDCLYINM*

>peptide 2 (31 aa)
MNHGDKFSNDKYYLLCITMHVILIFDVLMIS*

>peptide 3 (32 aa)
MPKETLPTTIDVPRWVAVLSDVWCFQTLPHSL*

>peptide 4 (35 aa)
MIFICFLSKSFLGHWFKLNLSLFTMGATFVEQLFI*

>peptide 5 (32 aa)
MLGGCSLLCLVLPNSSSLCRWCILKGVDMSEF*

>peptide 6 (32 aa)
MVSSSFPACRYIFVHAEILSFLGLAIDHQEFM*

>peptide 7 (36 aa)
MDPTALSIHVEVINLDRLAACISQELRYLKSDPCLD*

>peptide 8 (66 aa)
MAVAFRVQCPRTELKNAVFLSVREDCSHSRQRYIAQYYRGQTRHVMIIYISESYKQLPVPETFRER*

>peptide 9 (62 aa)
MCEFYYFIDYLNCALYINCLCQLWHYLFIVYVSFYCSILFIYCLFKYKQNLLLLNSYLIKSS*

>peptide 10 (71 aa)
MIFYNNILKSILDYHFSNLLVIHFRASSSAVSMELVSVPIWNYLILLGPVWLTNTDKIFYLKLYSILILAI*

>peptide 11 (40 aa)
MSFMLKFLERDCFTSRSKHLSLVASKIYPHIKQENRFYSY*

>peptide 12 (55 aa)
MCSMTNFFYLIRFFMTKYLISMCLLRLSFLLFLVIKTVVELSQYILNDLEIKSKF*

>peptide 13 (43 aa)
MFHVGLPYSLMFGASKLFLTLCKWCILKGVETIEFGDQSLQFM*

>peptide 14 (70 aa)
MTRFLNFNKKVLRLVSQSNLIKNLKLVSEYSKTKNESLANISLSGVVEVVWSISTTIYLSAVESNLLVCH*

>peptide 15 (37 aa)
MLRLLIWIGLRLAYLRSCVTLSQILVWIEGSSIPLLF*

Sequence

>CNT30518418
TTAATATCTCATACTTTTGGACAGAGGTGAAAATGCCATGGCCGTTGCTTTCCGCGTTCAATGCCCTAGGACAGAGTTAAAAAATGCTGTATTTCTCAGT
GTACGTGAAGACTGTAGCCATTCAAGGCAACGATATATAGCTCAGTATTATCGGGGTCAGACGAGGCACGTGATGATCATATACATCAGCGAATCTTACA
AGCAATTGCCGGTTCCCGAGACTTTTCGTGAAAGGTAAAAGAAAACAGCCCCTGCCGACCCCCCACTATTATTTGTCATACCTAAATCACTATAAAAATA
CCCTCGGAACAACCTCATCTTTATGCCAAAGGTCCCTTGGTGGCTTCGAGAGTCATAAGTGGGTGGTGGTAGACCGGTCGTTGTGGCTGTGTAGCTTTCA
ATACCCTAAAAAGCTAACGTTTTGATGGGTATGTTTAGATAGGGTTTCCGAGGTCATTAGGGTTTTCAATGTCTTAACTGTGGGGTAGTGGCCCAAGAAA
AGTTTAGAGTGCCAAAGCACTTGTATTTGGAATTGGATGGGTCTTTGCTGATCTTGGTTTTAGTAGCTAGGTAGTTTTTTTATTTTTCGATTTTTTCTCT
TTGGATCGGGAAAGATTTTGTGACTAAATGGGTGCAGATTTCTGGGGTTTTACCAGCAAGTAGATCAATGGATCTGTATTAATTACTAGGTTTTGAGTCC
AGTTTAAGATGAACAGCTAGCTCAGCTGAGGTCTTAATTTCTAGGGTTTTCTTTCGCCCCCTCCTTTGCATGGTTGGTAAAAACCTGGGTAAAAGGAGTA
CTACTGGGTGAAAAACATCTTTTTCCTTTTGTTGTTTTGAAGTGGGGTTAGGGTTTTGGATTGATGTTACTGATGATGAGATTCAGAGCTGATGTAGGGT
TTAAGGAGTAGAGCTCCTTGAAGTCCAATGGAGGGTCTTGCTGGGTGGATTGAGCTGCTGAGTTATGGATCCCACAGCCCTATCCATACATGTTGAGGTT
ATTAATTTGGATAGGCTTGCGGCTTGCATATCTCAGGAGCTGCGTTACCTTAAGTCAGATCCTTGTTTGGATTGAAGGGAGCTCTATACCTCTACTCTTT
TAGCTCCCGAATTTAAATTAATTAATTATATATTATTTCTATTTAATTTGTTACTGATTATTAACCTATTTTTTCGTAGATTTATTTCATGTTGATTTCA
GTTCCATTTCAGCTTTCAATTGGGATGTTCTTTCCGTAATTTTTCTTTACAGTTTGTGGTTCTCAAAGGCAATATTCTTTCCATATTCTTTGTTGCAGTT
TCATTTGAAGAGTGCTTTCAGTAGTCCATGGTTTCTTCTTCTTTTCCCGCTTGCAGATATATCTTTGTGCATGCCGAGATCCTTTCATTTCTAGGCCTTG
CTATCGATCATCAGGAGTTCATGTAGTTGATTTATTATTTGTTTATTTCTAGGCTTTATCATCAATATTATTAGCAGATATCTGAAGAGGTCTGATGCTG
TTTATCAGTACGTATGTGCAATGTTTTTTAAGATGGTGAGAGAGGCTTCGGATGCCATGGCTTCTCGTATAATTGAGTAATGATTCAGAACACTGTAAAA
TGAGGAAATTTTTGTAAAATAATGTAATTTTTATATGATATTTTACAATAATATCCTTAAAAGTATTTTAGATTATCATTTTTCTAATTTATTAGTCATA
CATTTTCGTGCCTCCTCATCAGCAGTTAGTATGGAGTTAGTTTCTGTACCGATTTGGAATTATTTGATACTTCTAGGCCCGGTTTGGTTAACTAATACAG
ATAAAATATTTTATTTGAAGTTGTACAGTATATTAATTTTGGCTATCTAAATATAATATTTTATTTCTTAAATTTTAAAAATATTTATTTAAATAAACAG
TAAAAAATAGTATAAAATTATGAAAACTGATGTGAACAGTATATAAATAGTGAAAATTGGTGTAAACAGTATATGAACAGTATATAATTCAGGCATTTTA
TAAAATAGTGACACTCACTTTTTATCAAACAAAAAATTTTCACAATTTCCTAACACTCCACACTCTACATTATTTTCAATTTTTATTATTTTTTTTTATT
AAATATTTATTATATAAATAATAAATAAAAAATTTGAAATAATTTAAAAACAATAAACTCAAAAAAAAATTTTAAAAAAATATTAAAAATTTAAAAAATT
TAAAAAAGTGTGGAGTGTGGTGGAGGTTGTGTAGCAATGCTCTTTATCAAAACTATAAGATGTGAGAGAGTTTTTAATTTTTAAGAATTGGAAAATGTGT
GAATTTTATTATTTTATAGATTATTTGAATTGTGCACTGTATATAAATTGTTTATGTCAGCTTTGGCACTATTTATTTATTGTTTATGTCAGTTTTTATT
GTTCCATTTTGTTTATTTATTGTTTATTTAAGTACAAACAAAATCTCCTATTATTAAACTCATATTTGATAAAATCAAGTTGATCTATTATTATATATTG
AACATTATTACTAAAGAAAAATGAGAAACTCATCCTTTCTAAACCAAGAAGCTCCTTCATGCTGATACTTTATAATGATGCTATTATGATTACATCAATG
TTTGATTCAAGTTCAGGCTATTTCACAAACCACAAATGACACGGTTTCTAAATTTTAATAAAAAAGTTTTGAGATTGGTGTCCCAATCAAATTTGATAAA
AAATTTAAAACTGGTTTCAGAGTATTCAAAAACTAAGAACGAATCTCTAGCAAACATCTCTTTGAGTGGAGTTGTTGAAGTGGTGTGGTCTATATCCACC
ACTATCTATCTTAGTGCAGTCGAAAGTAATCTATTAGTGTGTCACTGAAAAGATCATTAAAGCATAAACACTTAAAACAGAATTATGAATTTTAATGCTT
AAATGGTATCTCTAGCCATTGAAATTCTTCATGTTAGGTGGTTGTTCTCTCTTATGTTTGGTGCTTCCAAATTCTTCCTCTCTCTGTAGATGGTGTATAT
TGAAGGGGGTTGATATGAGTGAGTTTTAATGATCATTTCAGTGACAATAATGAGTTACTTTCGATTGTATTGAGATTGATAGAGGTGGGGAGTGTACCAA
ACTATTTAAAAAACTTAACTTAAAGGGAAGTTTGGTGGAGATACGTTCAATATTCTCCTACTTGATTTACACTTTTAATCTTAAATCTCATTTTAAATCG
AAAATCTGTATCAAGTAATAAATATATGAACCATGGCGATAAATTCTCTAATGATAAGTATTACCTTTTATGTATTACTATGCATGTGATCCTTATATTT
GATGTGTTAATGATTTCTTAATGAATAAATCATATGCTTATTCTTGGTCTAACACAAATGAATTTTTTTTAAAATTAAATTAAGGTGCACATAAATATGA
GAAAAAAATCACAATAATTAAGAATTTCATAACATTGTCCATACAATAAAAAATTACATAATATAACTAAGTCTCATATTTATGTGCTCAATGACCAATT
TCTTTTATTTAATACGTTTCTTTATGACTAAATATTTAATATCGATGTGTTTACTTCGACTCTCATTTTTATTGTTCTTAGTCATAAAAACAGTAGTTGA
ATTATCGCAATACATTCTCAATGACTTAGAGATAAAATCTAAATTCTAAGTTCAGAAATAAAACTCTTAAGCCATACATTATGTGAAATGTCCTCAAAAC
AGAAGACGAACTCGGCGTCCCTAGTGGAAGTGGTAGTCATTCCAGAGTAGAAGTGACAGTCAAAGTTTGCTTGACACTCCTCCATGATATAGCTCCACTG
GCCATCATAAAAATGTATGTTGCTATTGATTTGCGTAAATCAACACAGCCAGCAAAATCAAAATCTAAGTAGTCAATCACTTCCAGATTGTCTATATATA
AACATGTAGTTTTTGACTCCTTGAAGGTACCTCATTACTTTCTTTGTAGATCTCCAGTGGTCTAAACCTGGATTACTCTGATATTGTCTCAACATTCCAA
AAACAAATGCAATGTCAGATCTTGTGTAAAACTGAGCATATATAAGGCTTCCGACAATAGAAGCATATAGAATGATCTTCATTTGTTTCCTTTCAAAGTC
GTTCTTAGGGCATTGGTTCAAATTAAACTTATCACTATTCACTATGGGAGCTACATTTGTTGAACAATTATTCATCTGAAATCTTAAAACTTTATTAATA
TAGGTTTCTTGAGACAGACCCAAGATGATTCGAAATCTATCTCTATGGATCTTAATGCCAATGACATAAGATGTCTCACCCATGTCCTTTATGTTGAAAT
TTTTAGAGAGAGATTGTTTCACCTCACGTAGCAAACATTTATCATTGGTTGCTAGCAAAATATACCCACATATAAAACAAGAAAATAGATTTTATTCTTA
CTGATATTCTGGTATATACATTGATCCATAATATTTTCTACAAAACCGAATGAAGAAATTACATTATAGAATTTCTTTAATGCGAAATAAACACTTAAAA
CAGAATCATGAACTTTAATGCCTAAGGAAACATTACCTACAACCATTGATGTTCCACGTTGGGTTGCCGTACTCTCTGATGTTTGGTGCTTCCAAACTCT
TCCTCACTCTCTGTAAATGGTGTATACTGAAGGGGGTTGAGACGATTGAGTTTGGGGACCAAAGCCTTCAGTTTATGTAGCCACCAAAAACTTTCATCAA
GCTTTCGGTGGGTGGTTATGCTTTAATGATCATTTCAGTGATACTAATGGGTTACTTTCGATTGCACTAAGATGGATAGTGGTGGGTATGGACCACACCA
TTTCAATGACTCCACTCAAAGTGAAGTTTGGTGAAGATACGTTCAACATTCTCTCACTTGGTCCACACTTTTAATCTTAAGTCTCATCTTAAACCGAAAA
TCTGTATTAAGTAATAAATACATGAATAATAGCGATAAGGCCTCTAATGACGAGTATTACCTTTCATTTATTACTATGTATT