Detailed information on CNT30517752


BLAST search results

BLAST vs Swiss-Prot:
sp|Q39817|CALX_SOYBN, E-value = 6e-87

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30676354Juglans regiaSetaria viridis59.350.680.78255forward
CNT30238817Juglans regiaBrassica oleracea57.9146.7278.71249forward
CNT30365925Juglans regiaSorghum bicolor62.5630.2979.55269forward
CNT30101562Juglans regiaOryza rufipogon54.4227.0882.48234forward
CNT3048947Juglans regiaCucumis sativus49.0714.9180.09211forward

Expression of CNT30517752

Peptides detected in this lncRNA

>peptide 1 (31 aa)
SKSSPERKFPFFFSSPSIKILTSLSGLNIAL*

>peptide 2 (44 aa)
MERSYQTPWVAILPLGVEGTSSTHHHILAHLGAGPQTVGQQFHL*

>peptide 3 (80 aa)
MKCTLFVEPHLSGPNIMEYGEELSNSLGCHPASWGRRYFKYAPPHSSPSWSRTSNCRTTVPSLRLKTWSSSFTIAYFLAFS

Sequence

>CNT30517752
CTCAAAATCATCACCAGAGAGGAAATTTCCCTTCTTCTTCTCCTCCCCATCTATTAAAATACTAACTTCATTATCCGGTCTCAATATAGCACTGTAGACG
TGGGACAGTTTGTCTGAGGGCACAGAAGGGGGGTACTTTAGATGGTGCTCGACATAATCCCCACTCTTGGGGTTCTTGTGCTTAAGGATGAAGTGCACCT
TGTTTGTTGAGCCACATTTATCAGGTCCAAACATTATGGAGTATGGAGAGGAGTTATCAAACTCCTTGGGTTGCCATCCTGCCTCTTGGGGTCGAAGGTA
CTTCAAGTACGCACCACCACATTCTAGCCCATCTTGGAGCCGGACCTCAAACTGTAGGACAACAGTTCCATCTTTGAGACTCAAAACCTGGTCTAGCTCT
TTTACTATTGCATACTTCCTAGCCTTCTCG