Detailed information on CNT30517378


BLAST search results

BLAST vs Swiss-Prot:
sp|Q7X9A0|RCA1_LARTR, E-value = 3e-80

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30698101Juglans regiaQuercus lobata18.8132.1581.41199forward
CNT30373758Juglans regiaArabidopsis thaliana16.0745.2185.88170forward
CNT30617865Juglans regiaSesamum indicum17.7769.3788.3188forward
CNT30727556Juglans regiaCorchorus capsularis28.1738.3586.91298forward
CNT30379330Juglans regiaManihot esculenta26.7555.9384.45283forward
CNT30524690Juglans regiaPhaseolus vulgaris19.1920.3889.66203forward
CNT30628493Juglans regiaVigna unguiculata23.0630.588.93244forward
CNT30712394Juglans regiaGlycine max32.1421.2687.06340forward
CNT3096945Juglans regiaSolanum tuberosum9.7437.7387.38103forward
CNT30185579Juglans regiaSecale cereale14.9341.3684.81158forward
CNT30295268Juglans regiaTriticum aestivum20.1352.3383.57213forward
CNT30223071Juglans regiaHordeum vulgare14.9321.1886.08158forward
CNT30392014Juglans regiaTriticum turgidum12.9526.4581.02137forward
CNT30562839Juglans regiaActinidia chinensis24.3941.0282.95258forward
CNT30171660Juglans regiaTrifolium pratense24.5779.5188.46260forward
CNT30144634Juglans regiaMedicago truncatula27.3273.3586.85289forward
CNT30439608Juglans regiaAegilops tauschii21.1718.6783.93224forward
CNT30662818Juglans regiaTriticum dicoccoides27.1377.3683.28287forward
CNT30310249Juglans regiaCamelina sativa11.915685.71126forward
CNT3060875Juglans regiaArabidopsis lyrata10.6825.5784.07113forward
CNT3075041Juglans regiaBrassica juncea13.5260.3486.01143forward
CNT30260820Juglans regiaBrassica rapa32.9930.7884.24349forward
CNT30136831Juglans regiaLolium perenne10.6821.982.3113forward
CNT306857Juglans regiaZea mays27.1313.4880.84287forward
CNT30609928Juglans regiaGossypium raimondii17.24084.62182forward
CNT30233037Juglans regiaAnanas comosus18.0563.2585.34191forward
CNT30218871Juglans regiaKalanchoe fedtschenkoi12.6730.885.82134forward
CNT3068390Juglans regiaLeersia perrieri16.8233.6584.83178forward
CNT30208512Juglans regiaHelianthus annuus26.9442.2287.37285forward
CNT30684251Juglans regiaTriticum urartu26.1827.2182.67277forward
CNT30355777Juglans regiaLactuca sativa24.5767.3686.92260forward
CNT30642662Juglans regiaCannabis sativa21.4644.2586.78227forward
CNT3034456Juglans regiaTheobroma cacao15.576.2893.29164forward
CNT3024431Juglans regiaPopulus trichocarpa33.7474.3885.99357forward
CNT30327105Juglans regiaAsparagus officinalis21.0826.3978.92223forward
CNT30120246Juglans regiaCitrus clementina24.7667.1888.17262forward
CNT3038844Juglans regiaCucumis melo20.9830.9285.14222forward
CNT30151279Juglans regiaBrachypodium distachyon11.8122.6487.2125forward
CNT30604727Juglans regiaOryza punctata10.6842.3287.61113forward

Expression of CNT30517378

Peptides detected in this lncRNA

>peptide 1 (46 aa)
MFPYSRSFSRVIWGCSKVGGPSFEFTSFFPTPATPTPETHFLTSSS*

>peptide 2 (61 aa)
MMGTRGFSSLLYIPGSWTFVGLSAMFMRVALTIWLLTVYWVVPPSRPAPASRSLMKRQHIFP

Sequence

>CNT30517378
TGCCTGTGAAAGAAAATTATAAAAGCTTAGGATAGTTTTCTCTTAGTCTTCACTCTTAATGTGCTTCTTTTTATTTAAGGAATGAGTACTGGGCAAGGGG
AGATGGAACGGATCTGGCCGAAGGGGAAGATCCAAGCTAGCTAGCTAGTGATCTCCGCTTCCTGATGATCATGATCAGTGTACTATCTTAAGGGGAAATT
TACCGTAAAGATTGCAAAAAAGAAGGATCCAAACCTCCCATCACGGCCTCTAGGGTCAAGGAGCTAACCCTAGAAAGTTCCTCTCTTAATAGCATCCTGG
TTGGCATCTCCAAGAGCAGCCTCGCTCAAGTACTTGTCGGCAAGCTGGACTCTCTTCACATTCTCTTGCTCTTGGACCAGCATGTTTCCGTACTCCAGGA
GCTTCTCGAGGGTCATCTGGGGCTGCTCGAAAGTTGGAGGTCCTTCCTTTGAGTTCACAAGTTTCTTCCCAACGCCCGCCACACCAACACCAGAAACCCA
CTTCCTCACTTCGTCATCATAAACTCTGGCCCTTAGAGCACCAAAGAAATCTGCAAAAGCATCAATAGCATAAATTATATTGAGCTATATATTTTTTGAA
GAAATTAGGTAGTCGTAAATATATACGAAGAACCAAAGGTTGTTAATCTATAGTTAGAACCAAATATTCTCTCTAATTGTAACTAACCGATTGATTGGCC
TGGGAAGGTGTCAACAACCTTGACAATGTCATCTTCAGCAACGTTGTCACTCCGGAATATTCCTTTGCAGACACCAATGCGGTCTTCCCGAGTAGGTGCC
CAGTAGAACTTCTCCATTCGACCATCACGGATGAGAGGAGCATAAAGTGTTGAGAAGTCGTTTCCAGTGACTATGATGGGGACACGTGGATTCTCCTCCT
TGTTGTACATACCAGGGAGCTGGACATTTGTTGGGTTATCAGCAATGTTCATGAGAGTTGCATTAACCATTTGGTTGTTGACTGTGTATTGGGTGGTTCC
ACCAAGTCGACCAGCTCCTGCATCCAGATCGTTGATGAAGAGGCAGCACATTTTTCCC