Detailed information on CNT30517362


BLAST search results

BLAST vs Swiss-Prot:
sp|Q9XEE6|C3H29_ARATH, E-value = 0.0

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30517362

Peptides detected in this lncRNA

>peptide 1 (30 aa)
MGGVEVAGIGIDDELRANGLITVMSSPPAE*

>peptide 2 (29 aa)
MPQSNFPSGELQSERDEGFLAEEEERLVG*

>peptide 3 (38 aa)
PALCTAALAKEEESHPHCHDYTAPSWCQNAPTSHEKHP*

>peptide 4 (37 aa)
MIILRLLGAKMPRPLMRNILNQGINPRDIRLINSRLH*

>peptide 5 (65 aa)
MAAIISGVLFSKAIFFDPILLPYQKLASLTSRPFSSTSLLKASRSSMADNSSKTEQSQKNPSFCF*

>peptide 6 (50 aa)
MRVFLLRRKRGWLDNLHEVGSCSGASEAHLEIVTGWVLWVLGKALAAGTT*

>peptide 7 (60 aa)
MKPGLKNTMCILTGIPLLACTFPKLRAWNTAIGVLPWVSSPSILPRMDKRALGPVMGVCP*

Sequence

>CNT30517362
CTCCTGCTCTATGTACAGCTGCTCTAGCCAAGGAGGAAGAATCTCACCCCCATTGCCATGATTATACTGCGCCTTCTTGGTGCCAAAATGCCCCGACCTC
TCATGAGAAACATCCTTAACCAAGGAATTAACCCAAGAGACATCAGGCTCATTAACTCCAGATTGCATTAAGGTTGTTTTAGCCACGTTGTTGTCACGGA
ACCGAAAAGAAGCAGACTTCTTGAGCTTGTTCAACTCATCTCCTTGAATGCCCCAATCCAATTTCCCATCAGGTGAGCTCCAATCTGAACGAGATGAGGG
TTTTCTTGCTGAGGAGGAAGAGAGGTTGGTTGGATAACTTGCACGAAGTTGGTTCATGTTCTGGCGCATCTGAAGCCCATTTGGAGATTGTAACTGGGTG
GGTGTTGTGGGTTTTAGGGAAAGCCCTTGCAGCTGGGACAACATAGAAGAATCAAGAGACCCAAAAATATCATCAAGAGACCCAAAAATATCATCAAGGT
TAGAAGGTTTCAAATCTCCCATCCGATTGAATTCCTTGTTCCAGTAGGATGGGGATGGGGATGAGAGACGGGTTATCTCGTCAATCAATTGCTGCTGCTG
GCTAGCATGACTTTCTAGGCCAAGCAATTCCATCTCCAAATCTAGATCTCTAGCGCTCAAAGCAGTCTTTAGCCGGCTGCCAGGGAGCTGCAATGCAGGT
GGAGTGAGGTTAAGTTTGTTTTGCCACAAGCTCCCACTCTTGGGAGATGAGGCGGCTGCCTGAGGAGACATGGGCGGGGTTGAAGTAGCAGGCATCGGCA
TAGATGACGAACTGAGAGCCAATGGGCTCATCACTGTCATGTCCAGTCCACCAGCCGAGTGAGATTTAGGTGAAGGCATAGCTGAACCGGTGGAAGCATA
CACAGGGCGCAATTCCTCAGCCTTGTGAGCAAAGAAGCAGACTTTACGTGCACACCCAGTCTCATCCTTGCAAATCCGGGTTCGATATTGGGCAGGATGA
AGCCAGGACTCAAAAACACCATGTGCATACTCACAGGCATCCCCCTTTTGGCATGTACCTTTCCGAAACTCCGGGCATGGAACACAGCTATAGGGGTACT
TCCGTGGGTCTCTTCTCCTAGCATTCTCCCCAGGATGGACAAAAGGGCACTCGGTCCAGTCATGGGAGTATGCCCTTGAGCAAGGCTTCACCTTGAAAGT
ATACATCCTAAACTCATCTGTCCCATATATCCCATTATTTATGTCCGGCAATGATACATCGATAGGGTATTCTTTCTTCTCAGTTCCTTCTTTCGAGAGC
TGAGGCGTTGCTATCTTCTGCCGATCTTCCTCTTCGGTTGTGATTTGATCACTTTCCCCAATTGAAACATCGCCTTTAAGCAGCAACTCAATTGCCTTCC
GATTTGAATTGGACGGTGACCTCGATGCAGGGCCAATCAAATCAACAGGCTTATTTCCATTAGCATTAACACAAGTAGCATCCGCACATGCATCAAGCAA
GCGCTTAATAATCCCAACTGAGGTATTGGTACCACCAGCAACGGCACAATGGAGTGCAGTGACCCTATCTGAACCACATACCCTATTGACATCAACCTTA
CCTGTCTCAATCATATACTTCAAAACCTTAACGCTACCAAACATGGCAGCAATCATAAGTGGTGTCCTCTTTTCGAAAGCCATCTTCTTCGACCCAATTC
TTCTACCATACCAAAAACTTGCCTCGTTGACGTCAAGACCCTTCTCTTCTACTTCACTCCTGAAGGCCTCGAGATCATCCATGGCAGACAATTCAAGCAA
AACCGAGCAATCACAGAAAAACCCATCGTTCTGTTTCTGAAATTCACCTTCCATCCCAAAGCTTGAGGAGGAAAGTCTACTGTTTGAACCACTGCACATA
TCCAG