Detailed information on CNT30516940


BLAST search results

BLAST vs Swiss-Prot:
sp|Q9M8S0|MBS1_ARATH, E-value = 2e-49

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30315899Juglans regiaCorylus avellana2.6827.1690.9166forward
CNT30562313Juglans regiaActinidia chinensis8.5333.9881.9210forward
CNT30687535Juglans regiaTriticum urartu6.8653.8282.25169forward
CNT30348261Juglans regiaEragrostis tef4.0234.1489.999forward
CNT30102338Juglans regiaOryza rufipogon8.1631.6584.58201forward
CNT30726674Juglans regiaLupinus angustifolius7.8429.6981.87193forward

Expression of CNT30516940

Peptides detected in this lncRNA

>peptide 1 (58 aa)
MGPSYLLPNLRHRPSRKTYEPNSRPYYKKIGMIPKEGKKKNTFYARINHHKVKGQQTI*

>peptide 2 (62 aa)
MSGAVTLQCGHSSLACPPFSTPERSASPAFPPPRFVVAASTFDAISFAVCFFGLAFPVIVRI*

>peptide 3 (70 aa)
TAQTSLVDGAKKCCVRVVVSISINGEYEKTVQGPKLLNTAVFSSINQPSKEEKEQHLIYTMIASNKHSLY*

>peptide 4 (32 aa)
MFYCITNTSYHIYVNDSPCIFSQNDLQNPTTS*

>peptide 5 (33 aa)
MRWVLHTYYRTLDIDQVERHMNQTPDHIIKKLA*

>peptide 6 (36 aa)
MILHAFSPKMIYKTQLRVKIITKKKVLSIPMYHNPT*

>peptide 7 (37 aa)
MHKFRICYIQSFLEQALFLLVYPSLATNSSYLRQRLK*

Sequence

>CNT30516940
ACAGCTCAAACGTCATTGGTTGATGGTGCTAAAAAATGCTGTGTAAGAGTTGTGGTCTCCATTAGCATCAATGGAGAGTATGAAAAAACAGTCCAAGGCC
CCAAACTCTTAAATACCGCAGTTTTTAGCAGCATCAACCAACCATCAAAAGAAGAAAAAGAACAACATTTGATTTATACAATGATTGCAAGCAACAAACA
CTCTTTATATTAATGAAATAATTGAGAAATACAGATAACATCTTGACTTACAAAGAACTTAATCCATCACAAACTTCAAGACATAATCAATTCAGGGGTA
TGCACAAGTTTCGCATATGCTATATACAGTCATTTCTTGAACAAGCCTTGTTCTTACTTGTTTATCCCTCCTTAGCAACTAACTCCTCTTACCTTAGACA
AAGGTTAAAGTAAAACCCTCAGATAAACAAGGAACCTACTCGAAGAAGCACCATGTTTTGGTTTGGATGGCAAGCCTAGCGAAGTTGTAAGCTCGAACCC
CTAGCAACCCATAGGGGTTGGCTCAAAAGGAAATGGCTTTGGTTTTGGGGGGTATGCTCCCCTCAAGTCTGCGCTTGGATGCAAGGAATTTCTAGGGGCA
CATCCCACTGGTAAAAAGTCAATAATTTACCTCATTCGCATGAAGTGGCGGGATTTAATTGGGTAAAAGACACATTGCATTTGCACGGTCTCCAGGATTC
CACGTCATCAAAAAAAATCTGCTGCTCCTATAAATATCAGCTAAAAACACTTCAACAATAAAGTTAGTATTAATGACCATTACTTCCGATTAACCGCATG
CATCCAAACCTAAAACACTGAATATCATGGTCTTCAAGGCTTCCATGTGCATTGTTTTATCTACTAGAAAACTTAGGACATGGAATTTATGATGCAAATA
TGAAGAAACCGAATATTATTCAGAGTCACAAACTATGTTGGCAACTTAACTAAAAGTCTAAACACCTATTTTAGATTGCAAATAGAGACTTCGGAAAACC
CTAAAACAAAAGGGATCCCAAACAATTAAGATAGAGCACAAGAACTGGACTGAGTTTAACTTTATTAGTCCTTAAGTTGCAAAAGTTGAATGAAAAACCA
AAGCCAAGAGCCCAAGAGACTTTCCACACTGACTATAGCATTCTAAACAACAGTATACACTAATGCTTTAGCAACCCCCACCCCACCACAACAGCATTAA
ATCAATTAAAATAACTCAAACTGAAGCTCAAAGGCTCAAGTTAACCAAATGAGATGGGTCCTTCATACCTATTACCGAACCTTAGACATAGACCAAGTAG
AAAGACATATGAACCAAACTCCCGACCATATTATAAAAAAATTGGCATGATCCCAAAGGAAGGAAAAAAAAAAAACACTTTCTACGCACGAATAAATCAC
CATAAAGTCAAAGGGCAACAAACTATATGAATACATTACATTTCCTCAATTCAAACCTGGGATTGATTGTTACTTGAAACCAAAGTTACCCCAAATTTCT
TATCTACCAAAAAACATTTGAGCTCAAGAAAATGTTTTACTGTATAACAAACACAAGCTACCACATATATGTAAATGATTCTCCATGCATTTTCTCCCAA
AATGATCTACAAAACCCAACTACGAGTTAAAATCATTACGAAAAAAAAAGTACTCTCAATTCCCATGTACCATAACCCCACATAATAATCATAGCATACA
ATTAACTAAGCACATCACATAATTTATTTTCACGAGTTCATAACAAGTAGCCATCATCATAGAGATCATCACCATCATCATCGTTAAGGCAGACAATATA
CATTCCAAACACACTAAAGTGCAAGCCAATCGCTTACTTAACTTTAAGAGATCAAAGAAAAGAAAAACCCCAACCGAAAAAAGACAGCGATAGGAACATT
GCGGACATGACGTAACGATTGGCTAATCATTCTTTCACTTCTTCAAGCTGCCGCGGATACCAGGACGGGGCTTGGAGGTGTCAGCGGCAACGGTGGCGTG
GCGATTGACGAGCTTGGACTCGTCGAAGGCGACCTTCGGGTGCTTGGCGTCGTGGTGGATCTGCATAGACTTGATGTCCGGCGCCGTCACCTTGCAGTGC
GGGCACTCGAGCTTGGCGTGCCCGCCCTTTTCCACGCCGGAACGATCAGCAAGCCCGGCCTTCCCACCGCCCCGGTTCGTCGTTGCCGCGTCGACCTTCG
ACGCGATCTCCTTCGCCGTGTGCTTCTTCGGCTTAGCCTTTCCCGTCATCGTCAGAATCTAAACCGACGGCTCAGAGAGAGAGGAGGAAGAAATGGACGG
CTAGGAGTGGTTGTTTGAGAAAACCCTAGTGGGAAGGAGAAAGGGACGGAAAAGGCTTGCTTGGTGGAGGCGTGTGAGATTATCTCTCAATATCACACAA
ATAAAGACATATATATATTGGCATCTGTGTTTGGTAGATGAGTTCTCTACTCCCTTTTTTTTT