Detailed information on CNT30516063


BLAST search results

BLAST vs Swiss-Prot:
sp|P69325|UBIQP_SOYBN, E-value = 0.0

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30500417Juglans regiaCoffea canephora86.5442.4581.05855forward
CNT3020367Juglans regiaCitrullus lanatus88.9778.2781.11879forward
CNT30401729Juglans regiaBeta vulgaris92.1166.4280.55910forward
CNT30525141Juglans regiaPhaseolus vulgaris89.2750.9582.99882forward
CNT30629001Juglans regiaVigna unguiculata92.3174.5182.46912forward
CNT30200107Juglans regiaPisum sativum82.4991.9982.33815forward
CNT30156153Juglans regiaPistacia vera67.4157.8184.68666forward
CNT3097337Juglans regiaSolanum tuberosum93.0280.9782.05919forward
CNT3086353Juglans regiaVigna radiata89.4741.2582.81884forward
CNT30511508Juglans regiaSolanum lycopersicum88.8767.1381.32878forward
CNT30609009Juglans regiaGossypium raimondii85.7388.7882.05847forward
CNT30625880Juglans regiaDaucus carota92.3175.583.33912forward
CNT30153579Juglans regiaPrunus persica66.541.4883.87657forward
CNT30418420Juglans regiaPapaver somniferum92.1152.9481.76910forward
CNT30706355Juglans regiaPrunus avium92.5159.4783.59914forward
CNT30642981Juglans regiaCannabis sativa87.6577.1881.76866forward
CNT3026527Juglans regiaPopulus trichocarpa9293.0482.73909forward
CNT30120072Juglans regiaCitrus clementina67.4157.2784.68666forward

Expression of CNT30516063

Peptides detected in this lncRNA

>peptide 1 (29 aa)
MSFHLLIASQQRSTSADPVGYPPCLGSLP*

>peptide 2 (88 aa)
MKGRLLLNIVICKSPPVFKLLACKDKPLLIWWNTFFVLNLRLDIVNCVRTLDLQCNGFSGQSLDKNLHSSTQTKHQMQGGLLLNVVIG*

>peptide 3 (31 aa)
MVSELSTSKVIVFPVKVFTKICIPPRRRSTK*

Sequence

>CNT30516063
TGCCAGAGCACCAAATTATATAACAAGTTCGTCAAATATTATAAGCCATTACACAACGGGAATTAAACAAGATTAGAAACCACCACGGAGGCGAAGAACA
AGGTGCAGAGTGGACTCCTTCTGTATATTGTAATCCGCCAGAGTCCTTCCATCTTCAAGCTGTTTACCCGCAAAGATAAGCCTCTGCTGATCTGGAGGTA
TTCCTTCTTTGTCCTGAATCTTTGCTTTCACATTATCAATTGTATCAGAACTCTCGACCTCCAAGGTAATGGTCTTCCCAGTCAATGTTTTCACAAAGAT
CTGCATCCCACCACGCAGGCGCAGCACCAGATGAAGGGTAGACTCCTTCTGAATATTGTAATCTGCAAGAGTCCTCCCGTCTTCAAGCTGCTTGCCTGCA
AAGATAAGCCTTTGCTGATCTGGTGGAATACCTTCTTTGTCCTGAATCTTCGCCTTGACATTGTCAATTGTGTCCGAACTCTCGACCTCCAATGTAATGG
TTTTTCCGGTCAGAGTCTTGACAAAAATCTGCATTCCTCCACGCAGACGAAGCACCAAATGCAAGGTGGACTCCTTCTGAATGTTGTAATCGGCTAATGT
CCTTCCATCTTCTAATTGCTTCCCAGCAAAGATCAACCTCTGCTGATCCGGTGGGATACCCTCCTTGTCTTGGATCTTTGCCTTGACATTATCTATGGTA
TCCGAGCTTTCAACTTCCAAGGTTATAGTTTTTCCCGTCAAGGTCTTCACAAAGATTTGCATACCACCGCGGAGACGAAGCACCAAGTGAAGGGTGGATT
CCTTTTGGATGTTATAGTCAGCCAAAGTGCGACCATCTTCAAGTTGCTTACCAGCGAAGATGAGCCTTTGCTGGTCTGGTGGGATACCCTCTTTGTCCTG
AATTTTGGCTTTTACATTGTCAATGGTGTCAGAGCTTTCCACCTCAAGGGTGATTGTCTTTCCAGTGAGAGTCTTGACAAAGATCTGC