Detailed information on CNT30514347


BLAST search results

BLAST vs Swiss-Prot:
sp|P08927|RUBB_PEA, E-value = 5e-36

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30672885Juglans regiaSetaria viridis9.3929.3381.21149forward
CNT30618440Juglans regiaSesamum indicum22.7623.0885.04361forward
CNT30145095Juglans regiaMedicago truncatula18.7945.6483.22298forward
CNT30355328Juglans regiaLactuca sativa13.5634.6280215forward
CNT30550930Juglans regiaOryza brachyantha11.7941.0180.75187forward

Expression of CNT30514347

Peptides detected in this lncRNA

>peptide 1 (85 aa)
MAAKVAFLASSIRSLRSSSSVSVAAPTFITATPPDNLAILSASFSESYTESVSDNSFFNCAILACNSSFDAASAIMVVESLVMEP*

>peptide 2 (56 aa)
MNQCSTTTWHNPFLYGSESGILGIFNTEFTVLKFCLRCSTHLYYSYPTRQFGNSLS*

>peptide 3 (30 aa)
MLYNRLLTFCTISAPSRSSASSSFSLIAGT*

>peptide 4 (53 aa)
MPDFSGGGFLWLSRGCFKLLRSMSYLSVCLFMQLGASEKQPNHSKTWFSFSHS*

>peptide 5 (47 aa)
MDKTPSGPTLSIASAIIAPIRSSFPADMVATAGKKTQKENPKFKKRN*

Sequence

>CNT30514347
GTGCCTACATTTTAAACACATCAATCAAAAGGTAAGAACCCCGCCAAGAAATTTAATCTTACACAGCAAGGAATAAACAAATCCATTTCACATAAATTAT
TCATCTAATAGACCAACAGCACCAAGGACATTGCTATAATTTAGTGGCACGCCAGATTCTTTTGATACAGCACAAACACCCACCCCTCGAGGATAACTGC
AGCTCTCTATACCGTAGCAGAAATCCAACCCAAAGCCACTTCTTGAAGCATGCCAGATTTTTCTGGTGGAGGGTTTCTGTGGCTTTCCAGAGGGTGCTTC
AAGCTTTTAAGAAGTATGAGCTACCTTTCAGTCTGTTTATTTATGCAGCTTGGGGCTTCTGAGAAGCAACCCAACCATTCTAAAACTTGGTTTAGCTTCT
CACATTCTTAAAAGCTGCAGCCATAATAAACTGGCGAGTGGGACATTCAAACCCAGTTTAGAAAAAAAAAAAAAAAACCATATTTTCTACACCAAAACTA
GTACCAAATTTAAATTAGCAGCAGCCCTCAACCAGTTTGCTACTCAACCAAAACTTCCATCAGTAGTTTATCATGTTATATAATAGACTTCTTACCTTCT
GCACAATATCAGCACCAAGCCGCTCATCTGCATCGTCAAGCTTCTCCTTAATTGCTGGAACATGAGTTGAGAGATGAACCAGTGCAGCACCACCACCTGG
CACAATCCCTTCCTCTATGGCAGCGAAAGTGGCATTCTTGGCATCTTCAATACGGAGTTTACGGTCCTCAAGTTCTGTCTCCGTTGCAGCACCCACCTTT
ATTACAGCTACCCCACCAGACAATTTGGCAATTCTCTCAGCTAGTTTCTCTGAGTCATACACTGAATCTGTCTCAGATAATTCCTTCTTCAATTGTGCTA
TCCTGGCTTGTAACTCATCCTTTGATGCAGCATCTGCAATAATGGTGGTGGAGTCCTTGGTGATGGAGCCTTAATTGCTGCCACATTGAGAATGCCCCGC
AACTTATTTACAACAAGTGTAGCCAAGGCCTCCCCAGTGACATCCTCTGCAATTATAAGCAACGGGGCTCTCAACTGAGTGGTCTTCTCTAACAAGGGAA
TTATGTCCTTTATTGCAGAAATCTTCTGATCTGTCACCAAGACTCTTGCATTCTCAAATTCAGCAATCAACTTTTCAGGGTTTGTGACAAATTGTGGGGA
GATATAACCTCTGTCAATCTGTGCACCAAAAGGAACCAAAACGGCAGATGAGCCTCAAACAACTACAAGCATGCTTATGCGCCACGCACACAATAAATCA
ACTCACGGTCTAGAATAAAAAAATACATAGACTCACTTCCATTCCTTCTTCGACTTCAACAGTTGTTTCAAATGAAGATGACGACTCGATGGACAAAACG
CCATCTGGCCCAACCTTGTCAATCGCATCCGCAATCATAGCCCCAATAAGATCATCATTCCCCGCAGATATGGTTGCAACAGCTGGAAAGAAAACCCAAA
AGGAAAATCCAAAATTTAAAAAAAGAAATTAAAGAAGTAAAAATTTTGTCACCAAATAAACAAATATTTCAAATAATAATAAAACA