Detailed information on CNT30514140


BLAST search results

BLAST vs Swiss-Prot:
sp|P12333|CB2A_SPIOL, E-value = 2e-131

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30272382Juglans regiaChenopodium quinoa27.159.6984.5271forward
CNT30380511Juglans regiaManihot esculenta35.149.8684.62351forward
CNT30404250Juglans regiaBeta vulgaris41.940.8479.95419forward
CNT30171121Juglans regiaTrifolium pratense49.556.3881.62495forward
CNT30217700Juglans regiaKalanchoe fedtschenkoi40.150.8281.55401forward
CNT30572261Juglans regiaVitis vinifera18.923.1189.95189forward
CNT3055216Juglans regiaAmborella trichopoda41.445.7581.16414forward
CNT30725369Juglans regiaLupinus angustifolius63.963.981.53639forward

Expression of CNT30514140

Peptides detected in this lncRNA

>peptide 1 (47 aa)
MVSQVLQWSLSSHNGLDKEPKHGKHGQSPILELLNLELSKCLWLPPG*

>peptide 2 (29 aa)
MAHREWITSSSRFLENVSGSADSPAVSQP*

>peptide 3 (29 aa)
MPLASSWVDWVCHLTKWPTCNTIALNCTH*

>peptide 4 (30 aa)
MGFQMRQAWVCPQFFSWLLCPHQGVQMRRE*

>peptide 5 (42 aa)
MVTLPSPRSSDEEGVSLTAWPAREGEERDIVEAAIGMKRKMYS

>peptide 6 (84 aa)
MAWTKNPNMENMANLPFLSSLTLSSANASGFLLGRLGLSPHQVAHLQYDSPQLHPLRSPVWPRWLECFVRGQGLDSPSSPTHLH*

Sequence

>CNT30514140
CAGCAAAGGATAGAACACTGAATTAAATTCAATACACAATAAAAGGATAGATGCCTGCTTGAAAAGAAATTGTGCTCTTTTAAAACAAGTTTTACAAGTA
CATTGTCCAGTGTCCACTGGTTTACATCAGCAGTAGCATCGAGCTAATTTCACACCACTTGCACATACAACTTTCACTCCAAATCCAAGAGCTTTCCTCA
CTTTCCAGGGACAAAGTTTGTGGCATATGCCCAAGCATTGTTGTTGACAGGGTCGGCCAAATGGTCAGCCAGGTTCTCCAGTGGTCCCTTTCCAGTCACA
ATGGCCTGGACAAAGAACCCAAACATGGAAAACATGGCCAATCTCCCATTCTTGAGCTCCTTAACCTTGAGCTCAGCAAATGCCTCTGGCTTCCTCCTGG
GTAGATTGGGTCTGTCACCTCACCAAGTGGCCCACCTGCAATACGATAGCCCTCAACTGCACCCATTAAGATCACCTGTGTGGCCCAGATGGCTAGAATG
CTTTGTGCGTGGACAAGGTTTGGATTCCCCAAGTAGTCCAACCCACCTTCACTAAAGATTTGGGCTCCGGCCTTGAACCAGACAGCTTCACCGAACTTGA
CCCCATTGCGGGCCAAGAGTTCGGGGAAAACACAACCAAGAGCTCCAAGCATGGCCCATCGCGAATGGATCACTTCGAGCTCACGGTTCTTAGAGAACGT
CTCAGGATCGGCCGATAGCCCAGCAGTGTCCCAACCATAATCACCTGGGAATTCTCCTGTGAGGTAGGATGGGGGCTCACCAGAGAATGGGCCCAAGTAC
TTAACACGATCGGGTCCATACCATGGGCTTCCAGATGAGACAGGCTTGGGTCTGCCCCCAGTTTTTCTCATGGTTACTCTGCCCTCACCAAGGAGTTCAG
ATGAGGAGGGAGTAAGCCTGACAGCTTGGCCAGCTAGAGAAGGAGAGGAGAGGGACATTGTTGAAGCAGCCATTGGTATGAAAAGGAAGATGTACAGCTT