Detailed information on CNT30513690


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30671254Juglans regiaSetaria viridis2.9128.8287.9583reverse complement
CNT30657665Juglans regiaTriticum dicoccoides2.9127.2186.7583reverse complement
CNT30360998Juglans regiaLactuca sativa2.9128.6286.7583forward

Expression of CNT30513690

Peptides detected in this lncRNA

>peptide 1 (30 aa)
MQSSCHLCKHFIIIINHAFVNCLYVIGLTY*

>peptide 2 (30 aa)
MKLNSIVIADQHSAVNMYPCHRTHSLLLTD*

>peptide 3 (30 aa)
MRNVSGFFQYLILIINNKIHMMIFCLFLST*

>peptide 4 (29 aa)
MFVILVYSGTNFKLNKIFHCNYYILLEAC*

>peptide 5 (42 aa)
MLVCLMINAILKIHVHVLKFHRYLIYSCHDIPSSLMKHMNMS*

>peptide 6 (44 aa)
KLQNALSDMSMFMKFRFGVFLGLQSNKSYSMVRNVFRIENTCDL*

>peptide 7 (49 aa)
MEPFNFKKFLAYINYLFLISVLICLSRLYHQNDGIRMKLHRISLQFTST*

>peptide 8 (61 aa)
MNLIFVQCFQNRECSACALCCKYHFFRSDITNLLWSAWLAGRQLMLPSKGPRSKYKITKEE*

>peptide 9 (31 aa)
MYGICNFVLYVLTLQSRLYPKRGWVRRSTYL*

>peptide 10 (41 aa)
MNHKLRIKNIFIMTQARMVNYSSGTPLFTIECINVEWSLLG*

Sequence

>CNT30513690
TAAGCTTCAAAATGCACTTAGTGATATGTCTATGTTCATGAAATTCAGATTTGGTGTTTTCTTGGGTTTGCAGAGCAATAAATCATATTCTATGGTTAGA
AATGTATTTAGAATAGAAAATACATGTGATTTATGAAGTTTTGTGAAATTTGGGGTTAAATTGCAATTATTGAAAGTTTTGGGATTAATATGCAATTTTT
AAGAGTAAAGGGGTTAGAGTGCAATTTTTGCTAAATTTTGGAAGTTTTGCTAACCATAGTATATATACTTATTTATTTCAGCCTTTGAAGTTAACTTTTT
AAAGTGAGGGAGTTCGTAAGTTAACTTCTAACTTGTGGTTTATGTTAGTATGCTTAATGATAAATGCCATATTAAAAATTCATGTTCACGTTCTAAAGTT
CCATAGATATTTGATTTATTCATGTCATGATATTCCGTCATCCCTCATGAAGCATATGAACATGTCATGAATCATAAGTTACGCATTAAAAATATTTTTA
TCATGACCCAAGCTAGGATGGTAAATTATTCTAGCGGAACTCCTTTATTTACTATAGAGTGCATAAATGTAGAGTGGAGTCTCCTAGGTTAACGAAGAAC
AGTTTGTGACCTCGAAAGAGATAGTAACAGTCTTGGAGCGAGGGTGCCTTCTCGCTAGTGGAGGCTAAAGAGTACTATAAGTGAAGGACGTTTACGCAAA
GTTTGAGTACTCTTGAGACGAAGCCACAAGTGGCGTTGCCCGTTGTGTGGTGAAGATAACCAGTAAGTGCACACGGTTTTTTGGGGAACTGTGAAGTACC
ATAAGTATGTTTAAAAGATGTTGTTATAATGATGATGATGATGTTACTCTCTTTTGCTAAAGAATCTGGATGGGAGAAAAATACAATTTTTGAGTAATGC
AAAGTTCATGTCATTTATGCAAACATTTCATTATTATTATTAACCATGCTTTTGTAAACTGTTTGTATGTTATTGGTCTAACTTACTGAGTTTGGATGTT
TGTAATTAAGGAGTATGCTACTCCAAAACATTTTATTTTACCTATATAAAAAAAAACATTGTATTGACTAGCTGTTGGTAAAATCTGCTTTGTTTATAAT
TATGAGTGATGTTTGTGATTTTAGTTTATTCTGGTACAAATTTTAAACTGAACAAAATTTTCCATTGCAATTATTATATATTGCTAGAAGCATGCTAGGT
ATTGCATATTATCTATCATGTACGGGATATGTAACTTTGTGTTGTATGTCCTGACGCTTCAGTCTCGGTTATATCCTAAGCGGGGTTGGGTGCGTCGCAG
TACTTACCTTTAAAAACAAATTATTTGTGCTCTACTTGGTATTAATTAACCCTCTAAACCAGCTGATCCCATTCCTTTATCAGTTGGATTGCCCTGCTTA
AGTTCTTCATCAACGAGGGAGCTGAAATACCTTATCACAATTACAGACCTCTGTAGACCTATCCAGGTATTTGTCTGTCTATCATATTAAATTCCTAGCT
TGATCAGTTGGATATGTTCTTGCTAAATAAAGGCCTCCCTCTACCCTATCCTACATCTCTCTCTACACAGGTATTAATTTTTCTTTGATCTCATACTAGA
TAGATCTAATCTTATATCTTTTTCATTGTTTCCACTATTAGCGAAGTGAATGGAACCTTTCAATTTCAAGAAGTTCCTAGCATATATTAATTACTTGTTC
CTTATTTCGGTATTAATTTGCTTGTCTAGATTATACCATCAAAATGATGGCATCCGTATGAAATTGCATCGAATATCACTTCAGTTCACGAGTACTTAAT
TGTGCAACTGCTTTCATTTTTAATGAATATATATCATTACTGATTTGATGAAACTGTGAAGTTAGGAAAATGGTGAGTTTTTGCATTACAGTACTAGTTC
GGATTGTCTCTTCAACTTGGTAACATGAAATTGAACTCGATAGTAATCGCGGATCAGCATTCTGCAGTGAATATGTATCCGTGCCATCGAACTCATAGCT
TATTGCTTACAGATTAGATCGGACCATTATCCTCCTAAATCCCCCCACGGGAGATTATAAAACACCACTTTATCAGGTAGTTATGGGAGATTATAATATG
ACTCAAATTGACTACTAAAAATTGTCCAACTACAAGTATTATGTTTACTACATAATACTAGGTTACCTGTAATATTCCAGGCGAACCAATATTTTCCAAT
ATGAGAAATGTCTCTGGTTTTTTCCAATATTTAATACTAATTATTAATAATAAAATCCACATGATGATATTTTGTCTATTTCTCTCTACATGATGGTTTT
TTTCAATAATAAGTGTTATATATTATTTTTGAAAAAGAGTGAAGTCTATTATTAAAAAATTTTTTTTTTTTTATATGAATCTTATATTTGTTCAATGTTT
TCAAAATCGAGAGTGCAGCGCATGTGCACTATGCTGCAAATATCATTTTTTTAGAAGTGATATCACCAATTTATTGTGGTCGGCTTGGCTTGCAGGCCGC
CAACTAATGCTTCCGTCGAAGGGGCCAAGGTCAAAATACAAGATCACAAAGGAAGAGTAGTAACCACCGCTCAGGATCTTGCCACACAACCAGGACCAGT
ACAAGAGTAGTACTAGGAAAGAGCAAAAGAGTACTGAAACCGGAAAGCAATATTATAGAAAACCATAAGTTGACAGTACGTTCGGTATTGCTCTTAGTAT
TCTATATTTTGTGTTTGGTGTTTTTTCTTTAAGCTGCATGGTTGATGGTCTGTGGGATATTGATGCCTTTTAATAGTACAATATACTTGTAATTGTTGTT
TTCTTATTTCCACCGGTCTTGAATTTGTAATCCTGTATGGGAATCCGAT