Detailed information on CNT30513593


BLAST search results

BLAST vs Swiss-Prot:
sp|P0CH33|UBQ11_ARATH, E-value = 1e-149

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30513593

Peptides detected in this lncRNA

>peptide 1 (37 aa)
MVSELSTSRVMVLPVRVFTKICMPPRRRSTRWRVDSF*

>peptide 2 (40 aa)
MVSELSTSKVIVFPVRVLTKICMPPRRRSTRWRVDSFWIL*

>peptide 3 (44 aa)
MPSLSWILALTLVMVLPVRVFTKICICGKQHHQRRLLDTTTLLST

Sequence

>CNT30513593
TTAGAATATAAAACTGCAAACCAAATTTATTTAGATGGCCCCAACAGGGCCTTAACCATATAAGGTGATTGTAGCATAACACAAACTTAAAAACATTTAA
ATTTATTTCTTAAAAACATAAGATTCACGGGAGCTTGGGGCCAATCCTTCAGAACCCACCACGGAGACGGAGGACAAGGTGAAGGGTAGACTCCTTTTGA
ATATTGTAGTCCGCAAGGGTGCGACCATCCTCCAGTTGCTTGCCGGCAAAAATCAGCCTCTGCTGGTCAGGTGGGATCCCCTCCTTGTCCTGGATCTTGG
CCTTCACATTGTCGATGGTGTCCGAGCTCTCCACCTCAAGGGTGATGGTCTTGCCCGTGAGGGTCTTCACGAAGATCTGCATGCCACCGCGGAGACGGAG
CACCAGGTGGAGGGTCGACTCCTTCTGAATATTGTAGTCGGCAAGGGTACGGCCGTCCTCCAGCTGCTTGCCGGCAAAGATCAGCCTCTGCTGGTCCGGT
GGGATACCCTCCTTGTCCTGGATCTTGGCCTTGACATTATCGATGGTGTCAGAGCTCTCAACCTCCAAGGTGATCGTCTTTCCCGTGAGGGTTTTGACGA
AAATCTGCATGCCACCACGGAGACGGAGCACGAGATGGAGGGTTGATTCCTTCTGGATATTGTAGTCGGCGAGGGTCCTGCCGTCTTCGAGCTGCTTTCC
GGCGAAGATCAGCCTCTGCTGGTCCGGTGGGATGCCTTCCTTATCCTGGATCTTGGCCTTAACGTTGGTGATGGTCTTGCCGGTGAGAGTTTTCACGAAG
ATTTGCATCTGTGGAAAACAACATCATCAGAGAAGACTTTTAGATACGACGACACTGCTGTCTACG