Detailed information on CNT30513443


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30378667Juglans regiaArabidopsis thaliana39.0825.7498.61288forward
CNT30525072Juglans regiaPhaseolus vulgaris31.0753.6398.25229reverse complement
CNT3088853Juglans regiaVigna radiata36.2365.9398.5267reverse complement

Expression of CNT30513443

Peptides detected in this lncRNA

>peptide 1 (68 aa)
MNGAKRFAEAVGCKKASVGERSALGGSTCASSGGRSGSENVGLSNANIGENPMPRKPKGSSARFIHGG*

>peptide 2 (59 aa)
MPLEPRASWFSPKCVEAQQLTGHLGVKHCFGAGRESGTKSRQTLNTRYDLKITGVKVGQ*

>peptide 3 (44 aa)
MGDKLHRREGNSPDHQLRLLNDRSVIKEVGVQRQPGGLPRSSHP*

Sequence

>CNT30513443
TATCCAATTCACTGCTTATGGACCCGAACCTGGGTGATCTATCCATGACCAGGATGAAGCTTGGGTGAAACTAAGTGGAGGTTCGAACCGACTGATGTTG
AAGAATTAGCGGATGAGTTGTGGTTAGGGGTGAAATGCCACTCGAACCCAGAGCTAGCTGGTTCTCCCCGAAATGCGTTGAGGCGCAGCAGTTGACTGGA
CATCTAGGGGTAAAGCACTGTTTCGGTGCGGGCCGCGAGAGCGGTACCAAATCGAGGCAAACTCTGAATACTAGATATGACCTCAAAATAACAGGGGTCA
AGGTCGGCCAGTGAGACGATGGGGGATAAGCTTCATCGTCGAGAGGGAAACAGCCCAGATCACCAGCTAAGGCTCCTAAATGACCGCTCAGTGATAAAGG
AGGTAGGGGTGCAGAGACAACCAGGAGGTTTGCCTAGAAGCAGCCACCCTTGAAAGAGTGCGTAATAGCTCACTGATCGAGCGCTCTTGCGCCGAAGATG
AACGGGGCTAAGCGATTTGCAGAAGCTGTGGGATGTAAAAAGGCATCGGTAGGGGAGCGTTCTGCCTTAGGGGGAAGCACCTGCGCGAGCAGCGGTGGAC
GAAGCGGAAGCGAGAATGTCGGCTTGAGTAACGCAAACATTGGTGAGAATCCAATGCCCCGAAAACCTAAGGGTTCCTCCGCAAGGTTCATCCACGGAGG
GTGAGTCAGGGCCTAAGATCAGGCCGAAAGGCGGCGG