Detailed information on CNT30513419


BLAST search results

BLAST vs Swiss-Prot:
sp|P0CH33|UBQ11_ARATH, E-value = 2e-155

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30710308Juglans regiaGlycine max73.4868.0787.6629forward
CNT3044330Juglans regiaPrunus dulcis78.0454.6288.02668forward
CNT30169882Juglans regiaPistacia vera76.6431.886.28656forward
CNT30635990Juglans regiaCapsicum annuum74.5330.7886.21638forward
CNT30562217Juglans regiaActinidia chinensis76.9965.4486.49659forward
CNT30312659Juglans regiaCamelina sativa77.5733.7285.84664forward
CNT3079055Juglans regiaBrassica juncea76.6460.5785.52656forward
CNT30217431Juglans regiaKalanchoe fedtschenkoi76.9948.6787.25659forward
CNT30653057Juglans regiaRosa chinensis78.0450.4987.28668forward
CNT30704857Juglans regiaPrunus avium77.9242.2488.31667forward
CNT30174646Juglans regiaVigna angularis77.163.3487.88660forward
CNT30114615Juglans regiaEutrema salsugineum77.4567.5885.97663forward

Expression of CNT30513419

Peptides detected in this lncRNA

>peptide 1 (37 aa)
MVSELSTSRVMVLPVRVFTKICMPPRRRSTRWRVDSF*

>peptide 2 (40 aa)
MVSELSTSKVIVFPVRVLTKICMPPRRRSTRWRVDSFWIL*

>peptide 3 (32 aa)
MPSLSWILALTLSMVSELSTSRVMVLPVRPFLF

Sequence

>CNT30513419
CGATAGAGAATCTACGGCATAAGTATTAGAATATAAAACTGCAAACCAAATTTATTTAGATGGCCCCAACAGGGCCTTAACCATATAAGGTGATTGTAGC
ATAACACAAACTTAAAAACATTTAAATTTATTTCTTAAAAACATAAGATTCACGGGAGCTTGGGGCCAATCCTTCAGAACCCACCACGGAGACGGAGGAC
AAGGTGAAGGGTAGACTCCTTTTGAATATTGTAGTCCGCAAGGGTGCGACCATCCTCCAGTTGCTTGCCGGCAAAAATCAGCCTCTGCTGGTCAGGTGGG
ATCCCCTCCTTGTCCTGGATCTTGGCCTTCACATTGTCGATGGTGTCCGAGCTCTCCACCTCAAGGGTGATGGTCTTGCCCGTGAGGGTCTTCACGAAGA
TCTGCATGCCACCGCGGAGACGGAGCACCAGGTGGAGGGTCGACTCCTTCTGAATATTGTAGTCGGCAAGGGTACGGCCGTCCTCCAGCTGCTTGCCGGC
AAAGATCAGCCTCTGCTGGTCCGGTGGGATACCCTCCTTGTCCTGGATCTTGGCCTTGACATTATCGATGGTGTCAGAGCTCTCAACCTCCAAGGTGATC
GTCTTTCCCGTGAGGGTTTTGACGAAAATCTGCATGCCACCACGGAGACGGAGCACGAGATGGAGGGTTGATTCCTTCTGGATATTGTAGTCGGCGAGGG
TCCTGCCGTCTTCGAGCTGCTTTCCGGCGAAGATCAGCCTCTGCTGGTCCGGTGGGATGCCTTCCTTATCCTGGATCTTGGCCTTAACGTTGTCGATGGT
GTCGGAGCTCTCCACCTCGAGGGTGATGGTCTTGCCGGTGAGACCCTTTTTATTTC