Detailed information on CNT30511543


BLAST search results

BLAST vs Swiss-Prot:
sp|P69322|UBIQP_PEA, E-value = 0.0

BLAST vs NONCODE:
NONSTUT001005, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30547563Solanum lycopersicumIpomoea triloba57.8192.7584.84640forward
CNT30406246Solanum lycopersicumBeta vulgaris57.995.5383641forward
CNT30311003Solanum lycopersicumCamelina sativa80.1375.381.85887forward
CNT3061767Solanum lycopersicumArabidopsis lyrata79.7754.0782.33883forward
CNT30642231Solanum lycopersicumCannabis sativa77.1580.5781.38854forward

Expression of CNT30511543

Peptides detected in this lncRNA

>peptide 1 (40 aa)
MVSELSTSNVIVFPVKVFTKICIPPLKRNTRWRVDSFWML*

>peptide 2 (76 aa)
MKGRLFLDVVISKCSAIFKLFPSKDQSLLIWRNAFLVLNLSFDIINGVRTLNLKSDGLSGECLNKYLHLKYIEAQLS

>peptide 3 (37 aa)
MVSELSTSNVIVFPVKVLTKICMPPLRRRTRCKVDSF*

>peptide 4 (30 aa)
MKSRLFLDVIVCKGAAILKLLTSKDEPLLI*

Sequence

>CNT30511543
CAGCCATCATGAAATCAGCAGCACACAGGACATTCACAAGTCACCGCCACGGAGCCTCAGGACAAGATGAAGAGTAGACTCTTTCTGGATGTTATAGTCT
GCAAGGGTGCGGCCATCCTCAAGCTGCTTACCAGCAAAGATGAGCCTCTGTTGATCTGATCTGCATCCCTCCTCTCAAACGCAACACCAGATGGAGAGTT
GACTCCTTCTGGATGTTGTAGTCTGCAAGAGTCCTCCCATCCTCAAGTTGTTTACCAGCAAAGATCAAACGCTGTTGGTCTGGGGGAATACCCTCCTTGT
CTTGAATCTTTGCTTTCACATTGTCAATGGTATCTGAACTCTCAACCTCCAATGTGATTGTCTTCCCAGTCAAAGTCTTCACAAAGATCTGCATCCCTCC
TCTCAAACGCAACACCAGATGGAGAGTTGACTCCTTCTGGATGTTGTAGTCTGCAAGAGTCCTCCCGTCCTCAAGTTGTTTACCAGCAAAGATCAAACGC
TGTTGGTCTGGGGGAATACCCTCCTTGTCTTGAATCTTTGCTTTCACATTGTCAATGGTATCTGAACTCTCAACCTCCAATGTAATTGTCTTCCCAGTCA
AAGTCTTGACAAAAATTTGCATGCCACCTCTAAGGCGAAGAACAAGATGTAAGGTAGACTCTTTCTGAATATTGTAGTCAGCCAGGGTCCTTCCATCCTC
AAGTTGCTTGCCGGCAAAGATCAGTCTCTGCTGGTCTGGAGGAATCCCTTCCTTATCCTGAATTTTGGCCTTCACATTGTCAATAGTATCGGAACTTTCA
ACTTCAAGGGTGATGGTCTTTCCAGTAAGTGTCTTGACAAAGATCTGCATACCACCACGAAGGCGAAGGACAAGATGAAGGGTAGACTCTTTTTGGATGT
TGTAATCAGCAAGTGTTCGGCCATCTTCAAGCTGTTTCCCAGCAAAGATCAGTCTCTGCTGATCTGGAGGAATGCCTTCCTTGTCTTGAATCTTAGCTTT
GACATTATCAATGGTGTCAGAACTCTCAACCTCAAGAGTGATGGTCTTTCCGGTGAGTGTCTTAACAAATATCTGCATCTGAAATATATTGAAGCACAAC
TGTCAAA