Detailed information on CNT30511508


BLAST search results

BLAST vs Swiss-Prot:
sp|P0CG85|UBI1P_NICSY, E-value = 0.0

BLAST vs NONCODE:
NONSTUT001005, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30516063Solanum lycopersicumJuglans regia67.1388.8781.32878forward
CNT30701438Solanum lycopersicumQuercus lobata85.0276.2280.761112forward
CNT30615967Solanum lycopersicumSesamum indicum85.1733.1384.561114forward
CNT30272593Solanum lycopersicumChenopodium quinoa84.5645.9584.181106forward
CNT3019984Solanum lycopersicumCitrullus lanatus67.257.9481.8879forward
CNT30727318Solanum lycopersicumCorchorus capsularis49.8557.1483.74652forward
CNT30379426Solanum lycopersicumManihot esculenta66.6775.382.68872forward
CNT30406245Solanum lycopersicumBeta vulgaris49.0198.3183.62641forward
CNT30629220Solanum lycopersicumVigna unguiculata68.8183.3383.11900forward
CNT30200107Solanum lycopersicumPisum sativum61.8591.3182.2809forward
CNT30709517Solanum lycopersicumGlycine max71.1100.1182.58930forward
CNT30156153Solanum lycopersicumPistacia vera65.5274.3984.01857forward
CNT30637458Solanum lycopersicumCapsicum annuum87.6926.1284.741147forward
CNT3097927Solanum lycopersicumSolanum tuberosum83.9482.6294.541098forward
CNT30568725Solanum lycopersicumActinidia chinensis83.4194.0581.211091forward
CNT3086353Solanum lycopersicumVigna radiata86.3952.7381.951130forward
CNT30538027Solanum lycopersicumBrassica napus68.2747.182.53893forward
CNT30172216Solanum lycopersicumTrifolium pratense68.8852.8881.8901forward
CNT30145248Solanum lycopersicumMedicago truncatula85.0256.6582.821112forward
CNT30311152Solanum lycopersicumCamelina sativa85.0268.9481.651112forward
CNT3079055Solanum lycopersicumBrassica juncea67.5881.6382.01884forward
CNT30460578Solanum lycopersicumSaccharum spontaneum85.6355.9781.161120forward
CNT30605652Solanum lycopersicumGossypium raimondii68.0490.2682.47890forward
CNT30623607Solanum lycopersicumDaucus carota86.3949.583.11130forward
CNT30153909Solanum lycopersicumPrunus persica44.1970.2385.29578forward
CNT30408298Solanum lycopersicumPapaver somniferum82.9575.8783.231085forward
CNT30706356Solanum lycopersicumPrunus avium84.7179.7783.031108forward
CNT30642981Solanum lycopersicumCannabis sativa66.6777.7282.68872forward
CNT3028051Solanum lycopersicumTheobroma cacao82.0388.0282.111073forward
CNT30120072Solanum lycopersicumCitrus clementina59.6367.0783.97780forward
CNT30330510Solanum lycopersicumDioscorea rotundata60.9384.8883.19797forward
CNT30595410Solanum lycopersicumEragrostis curvula85.2481.7481.351115forward
CNT30111644Solanum lycopersicumFicus carica84.5677.6181.461106forward
CNT30334109Solanum lycopersicumCynara cardunculus85.1769.3681.61114forward
CNT30724005Solanum lycopersicumLupinus angustifolius66.9767.8582.65876forward

Expression of CNT30511508

Peptides detected in this lncRNA

>peptide 1 (40 aa)
MVSELSTSNVIVFPVKVFTKICIPPLKRNTRWRVDSFWML*

>peptide 2 (31 aa)
MVSELSTSRVIVFPVRVLTKICIPPRRRRTR*

>peptide 3 (37 aa)
MVSELSTSNVIVFPVKVLTKICMPPLRRRTRCKVDSF*

>peptide 4 (30 aa)
MKSRLFLDVIVCKGAAILKLLTSKDEPLLI*

>peptide 5 (67 aa)
MKGRLFLDVVISKCSAIFKLFPSKDQSLLIWRNAFLVLNLSFDIINGVRTLNLKSDGLSGECLNKYLH

Sequence

>CNT30511508
CAGCCATCATGAAATCAGCAGCACACAGGACATTCACAAGTCACCGCCACGGAGCCTCAGGACAAGATGAAGAGTAGACTCTTTCTGGATGTTATAGTCT
GCAAGGGTGCGGCCATCCTCAAGCTGCTTACCAGCAAAGATGAGCCTCTGTTGATCTGATCTGCATCCCTCCTCTCAAACGCAACACCAGATGGAGAGTT
GACTCCTTCTGGATGTTGTAGTCTGCAAGAGTCCTCCCATCCTCAAGTTGTTTACCAGCAAAGATCAAACGCTGTTGGTCTGGGGGAATACCCTCCTTGT
CTTGAATCTTTGCTTTCACATTGTCAATGGTATCTGAACTCTCAACCTCCAATGTGATTGTCTTCCCAGTCAAAGTCTTCACAAAGATCTGCATCCCTCC
TCTCAAACGCAACACCAGATGGAGAGTTGACTCCTTCTGGATGTTGTAGTCTGCAAGAGTCCTCCCGTCCTCAAGTTGTTTACCAGCAAAGATCAAACGC
TGTTGGTCTGGGGGAATACCCTCCTTGTCTTGAATCTTTGCTTTCACATTGTCAATGGTATCTGAACTCTCAACCTCCAATGTAATTGTCTTCCCAGTCA
AAGTCTTGACAAAAATTTGCATGCCACCTCTAAGGCGAAGAACAAGATGTAAGGTAGACTCTTTCTGAATATTGTAGTCAGCCAGGGTCCTTCCATCCTC
AAGTTGCTTGCCGGCAAAGATCAGTCTCTGCTGGTCTGGAGGAATCCCTTCCTTATCCTGAATTTTGGCCTTCACATTGTCAATAGTATCGGAACTTTCA
ACTTCAAGGGTGATGGTCTTTCCAGTAAGTGTCTTGACAAAGATCTGCATACCACCACGAAGGCGAAGGACAAGGTGAAGGGTGGACTCCTTTTGGATGT
TGTAATCAGCAAGTGTTCGGCCATCTTCAAGCTGTTTCCCAGCAAAGATCAGCCTCTGCTGGTCTGGGGGAATACCTTCCTTGTCTTGAATTTTAGCTTT
GACATTATCGATGGTGTCTGAGCTCTCGACCTCAAGAGTTATAGTCTTTCCGGTCAGAGTTTTAACAAAGATTTGCATCCCACCACGTAGACGGAGGACA
AGATGAAGGGTAGACTCTTTTTGGATGTTGTAATCAGCAAGTGTTCGGCCATCTTCAAGCTGTTTCCCAGCAAAGATCAGTCTCTGCTGATCTGGAGGAA
TGCCTTCCTTGTCTTGAATCTTAGCTTTGACATTATCAATGGTGTCAGAACTCTCAACCTCAAGAGTGATGGTCTTTCCGGTGAGTGTCTTAACAAATAT
CTGCATCT