Detailed information on CNT30511372


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONCQUT004405, E-value = 4e-120

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30511372

Peptides detected in this lncRNA

>peptide 1 (36 aa)
MAHLELLILWRSSTKQSHRPTYLKFENRSRALRHRGL

Sequence

>CNT30511372
GCGCGCTTAAGCTCCATCCATTTTCGGGGCTAGTTGATTCGGCAGGCGAGTTGTAACACACTCTTTAGCGGATTTCGGCTTCCATGACCACCGTCCTGCT
GTCTTAATTGACCAACACCCTTTGTGGGATCTAGGTTAGCGCACAGTTTCGCACCGTAACCCGGCTTCCGATTCATCCTGCATCGCCAGTTCTACTTACC
AAAAATGGCGCACTTGGAGCTCTTGATTCTGTGGCGCAGCTCAACAAAGCAGTCGCACCGTCCTACCTATTTGAAGTTTGAGAATAGGTCGAGGGCGTTG
CGCCACCGAGGCCTC