Detailed information on CNT30510544


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30510544

Peptides detected in this lncRNA

>peptide 1 (71 aa)
SRTKLRVSSIKKDGFVNEKYKFPIGKSINGTISNCSGGPLISNCENGPLISNCSGGMETRSFTRSAYSDGPL

>peptide 2 (42 aa)
MAQSQIVQVGHLFLIVKMGHLFLIVQVGWRRDLSLDPLTLMGH

Sequence

>CNT30510544
AAAGTAGGACCAAACTGAGAGTTAGTAGCATAAAAAAAGATGGATTTGTGAATGAAAAATACAAGTTTCCAATAGGAAAATCCATCAATGGCACAATCTC
AAATTGTTCAGGTGGGCCACTTATTTCTAATTGTGAAAATGGGCCACTTATTTCTAATTGTTCAGGTGGGATGGAGACGAGATCTTTCACTAGATCCGCT
TACTCTGATGGGCCACTT