Detailed information on CNT30510505


BLAST search results

BLAST vs Swiss-Prot:
sp|O23755|EF2_BETVU, E-value = 1e-140

BLAST vs NONCODE:
NONGMAT000778, E-value = 2e-53

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30674834Solanum lycopersicumSetaria viridis1423.7190.79152forward
CNT30532226Solanum lycopersicumEucalyptus grandis31.447.1685.92341forward
CNT30316236Solanum lycopersicumCorylus avellana20.5348.5891.03223forward
CNT30547574Solanum lycopersicumIpomoea triloba15.4747.3292.26168forward
CNT30512729Solanum lycopersicumJuglans regia54.1457.1485.03588forward
CNT30372986Solanum lycopersicumArabidopsis thaliana45.5848.4384.65495forward
CNT30276060Solanum lycopersicumChenopodium quinoa32.555.6885.27353forward
CNT3019597Solanum lycopersicumCitrullus lanatus34.6250.2781.91376forward
CNT30379936Solanum lycopersicumManihot esculenta22.7473.9587.45247forward
CNT30488117Solanum lycopersicumOlea europaea16.0235.6691.38174forward
CNT30711584Solanum lycopersicumGlycine max27.943.0485.15303forward
CNT3045373Solanum lycopersicumPrunus dulcis50.0969.3984.38544forward
CNT30191304Solanum lycopersicumSecale cereale42.6335.5986.39463forward
CNT30300473Solanum lycopersicumTriticum aestivum50.3756.5183.73547forward
CNT30224354Solanum lycopersicumHordeum vulgare41.5386.986.03451forward
CNT30395070Solanum lycopersicumTriticum turgidum38.9555.2985.58423forward
CNT30561656Solanum lycopersicumActinidia chinensis51.6640.0784.14561forward
CNT3085191Solanum lycopersicumVigna radiata22.8434.5984.68248forward
CNT30552635Solanum lycopersicumOryza glaberrima27.1628.4289.83295forward
CNT30143941Solanum lycopersicumMedicago truncatula16.8540.8581.97183forward
CNT30441158Solanum lycopersicumAegilops tauschii50.1871.8183.67545forward
CNT30309793Solanum lycopersicumCamelina sativa45.2163.1182.08491forward
CNT3059659Solanum lycopersicumArabidopsis lyrata18.9747.4787.86206forward
CNT30135610Solanum lycopersicumLolium perenne19.7125.388.32214forward
CNT3014085Solanum lycopersicumZea mays25.0544.5987.87272forward
CNT30605685Solanum lycopersicumGossypium raimondii38.7755.184.32421forward
CNT30203835Solanum lycopersicumHelianthus annuus15.0133.9685.89163forward
CNT30684236Solanum lycopersicumTriticum urartu38.9551.4684.87423forward
CNT30345702Solanum lycopersicumEragrostis tef47.4263.7482.72515forward
CNT30361520Solanum lycopersicumSorghum bicolor26.1541.5282.39284forward
CNT30596122Solanum lycopersicumOryza meridionalis31.2248.9985.25339forward
CNT30359537Solanum lycopersicumLactuca sativa29.2848.2584.59318forward
CNT30369654Solanum lycopersicumOryza glumipatula27.1633.5290.17295forward
CNT30154011Solanum lycopersicumPrunus persica14.9257.6583.95162forward
CNT30107537Solanum lycopersicumOryza longistaminata27.1632.189.83295forward
CNT30332479Solanum lycopersicumDioscorea rotundata10.4139.9384.96113forward
CNT30149525Solanum lycopersicumBrachypodium distachyon8.2929.883.3390forward
CNT30100253Solanum lycopersicumOryza rufipogon27.1626.7789.83295forward
CNT30575986Solanum lycopersicumOryza barthii39.4136.2485.98428forward
CNT30497456Solanum lycopersicumDigitaria exilis25.695.2189.57278forward
CNT30116094Solanum lycopersicumOryza nivara27.1633.5289.83295forward
CNT30604019Solanum lycopersicumOryza punctata24.2277.8187.83263forward
CNT3050899Solanum lycopersicumCucumis sativus14.5562.784.18158forward

Expression of CNT30510505

Peptides detected in this lncRNA

>peptide 1 (32 aa)
GKIFVSVNDIKESNKIAHLRFKLLHENGKTNC*

>peptide 2 (75 aa)
MKNNITDFKANTSHVLFSQCTFLRSPLETSNNRILNFIQVLNSLTHIHHHVGTSCLRTKAPNLLCKIFVPAKLLSQ

Sequence

>CNT30510505
GGGCAAGATTTTTGTCTCTGTAAATGACATAAAAGAAAGTAACAAAATAGCTCACTTACGGTTCAAACTCCTACATGAAAATGGTAAAACTAACTGCTAA
AACACATATAAATGTAAAACAAAACTTCTGCAGATCCAATTAAGCAAAAGTGTCCATCAAAAACCTCTGCCAAGTTGAAACTTCCACAAGCTTACAGCTT
GTCCTCAAACTCGGATAGAGGGGTCATCTGATCCTTCAAACCCTTCCTCTTGCGGATATCAAGGACGAGTTGATGAGCTTGTGAGCCAGCTTCCAATGGG
TCAGAGGACATCATTTCCCAATGATCAAACACACACTGTGGGAAGGCTTGACCTGAAGTAGCAGCTCTCAAGGTACCTGAAAATCCAAAAGACTCAACAA
CAGGAAGGTAAGCCTTGATGTTGTAAAGAGGAGTTCCTGGGGTCATCTGATCCTTCAAACCCTTCCTCTTGCGGATATCAAGGACGAGTTGATGAGCTTG
TGAGCCAGCTTCCAATGGGTCAGAGGACATCATTTCCCAATGATCAAACACACACTGTGGGAAGGCTTGACCTGAAGTAGCAGCTCTCAAGGTACCTGAA
AATCCAAAAGACTCAACAACAGGAAGGTAAGCCTTGATGTTGTAAAGAGGAGTTCCTGGCCTCTGCATCTCCTCAAACACGTGTCCACGCTTCTGATTCA
GAACACTATAGATACCACCAAGGGCTTGCTCCGGAGCCTGAATTTCCACAAGGTAAACGGGCTCCAACAGGCGGGGTTTAGCAGTAAGCTGAGAAGCATA
GATAACCCTCCTAGCAGTGGGAATAACTTGGCCACCACCCCTGTGAATAGCATCAGAATGAAGAACAACATCACAGACTTCAAAGCAAATACCTCTCATG
TTCTCTTCAGCCAATGCACCTTCCTTCGAAGCCCACTGGAAACCAGCAACAACAGAATCCTTAATTTCATTCAGGTACTGAACTCCCTTACACATATCCA
CCACCATGTTGGGACCAGTTGTCTCAGGACCAAAGCACCAAATCTTCTTTGCAAGATCTTTGTCCCAGCCAAACTCCTCAGCCAAG