Detailed information on CNT305094


BLAST search results

BLAST vs Swiss-Prot:
sp|Q9SZL7|FRS9_ARATH, E-value = 6e-25

BLAST vs NONCODE:
NONZMAT000221, E-value = 2e-137

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT305094

Peptides detected in this lncRNA

>peptide 1 (34 aa)
MLLICRTFASTIHLLSMYFLGTYFILLTSSIFSA*

>peptide 2 (38 aa)
MWFSPYSPDIPILPGGSAVKLNDGITTLAGSFVCAEVV*

>peptide 3 (59 aa)
CGIHELSKSDSDLIFKIFSISSAKFSAFLVEIKYASSDCDARTNILLKILHRWNSDLIS*

Sequence

>CNT305094
CTTGCGGTATTCACGAATTGTCCAAATCAGATTCAGACCTGATTTTCAAGATTTTCTCTATCTCTTCTGCTAAATTTTCAGCATTTTTAGTAGAAATAAA
GTATGCTTCATCGGACTGTGATGCTCGAACAAATATTCTGTTGAAAATTCTGCATAGATGGAATAGCGATTTGATATCTTGACTTTAGGATCCTCATGTA
TATTGCACATGCTGCTTATATGTAGGACTTTTGCATCAACAATCCATCTCTTAAGTATGTATTTCTTAGGAACATATTTTATATTATTGACATCTAGTAT
CTTTAGTGCATGAGAACATAAGATGCCAGCAAACTCAAACTTCTTGCAGCTGCATATGACAATTGATTCCAATGGAGAAAACTTAACAGTATGTTCGTGA
TGTTTTCCATGGACTCTTGATTTATACACCTTTTCTGCGCCATCATCACCACAGTAAAATAGATCACAATTTAAAGTTTGCAACACTTCCTCCTCAAATA
ACTTGAATATTGCTGGTGTATACACTTTTGCTGCTTGCTTAAATATTTCCAGTGCTGCCTTCGGCTTTGGTGTACTTTGTGTCGCTCTAAAATCACAGGC
TTTCATTTCTTTGGGTGGACACCATATCAGCAGAGAATGTGTTTCTGCCATATACTAATGCCCACAGATATCGTTTATCAAAAAGTCATTGAAGCCATTT
ATTCCCTTGAAGGTTGAATGTGGTTCTCTCCATATTCTCCAGATATTCCCATCCTACCAGGAGGATCAGCCGTGAAACTCAATGATGGAATTACAACTTT
AGCAGGATCCTTCGTCTGTGCTGAAGTAGTGTAGAATTCTGATGGGTCCATTGCATCATATGGTGTGTTCTATAGAATTAGGTATAGATGCAGTTCTATG
TTGTGGGTGATTGCTTGTGGAATAAAAATATTTATTTTATTTATGGCTAGTTTTGGCGGGGCATTTGTGAGGTCTTGGCGCTGATGTGTATTCTAGGCGG
TAGCTTTTTTACTTTTGGCACGCTAAGGAATCTAACGACATGAGTTGTAAATAAGCAAAGGGTTCTAGTGGGTCCAACCGTTGTA