Detailed information on CNT30509233


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30509233

Peptides detected in this lncRNA

>peptide 1 (33 aa)
GHHRPVIASNFRGLKGRSPSKKLAAKGYLRIAS*

Sequence

>CNT30509233
AAGGGCATCACAGACCTGTTATTGCCTCAAACTTCCGCGGCCTAAAAGGCCGTAGTCCCTCTAAGAAGCTTGCCGCGAAGGGATACCTCCGCATAGCTAG
TTAGCAGGCTGAGCTCTCAGTCTGTCAATCCTTACTATGTCTGGACCTGGTAAGTTTCCCCGTGTTGAGTCAAATTAAGCCGCAGGCTCCACTCCTGGTG
GTTCCCTTCGGTCAATTCC