Detailed information on CNT30509083


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30687374Solanum lycopersicumTriticum urartu520.9998.0451forward

Expression of CNT30509083

Peptides detected in this lncRNA

>peptide 1 (33 aa)
MSQTSRSHRPADGNRLTTGDIRVTSSALESKAE*

>peptide 2 (37 aa)
MYLQHRKQKLKTTKKIIKKVALPYLINLHYPGWTNFL*

>peptide 3 (54 aa)
MKVWSQLGVGIRYFGSISSSFSVFSISDSCKLCTEYRTEIFRFDFYYFSLIFLF*

>peptide 4 (56 aa)
TFIILKILPLIFTHYQISYPIQKRFDFQTIISLPLFTHTIKLVTILIKILIDFSLQ*

>peptide 5 (70 aa)
MDKFSLTFEDLPTENSELLSDMDRTVSRHSEPSSRTGIDLIGRHFYLTLSSINLMVDTKHVPNFSLPPAG*

Sequence

>CNT30509083
CCACGTTTATCATCCTCAAAATATTGCCTCTAATTTTTACTCATTACCAAATCAGTTATCCAATTCAAAAGCGATTTGATTTTCAGACAATTATATCTCT
CCCTCTTTTCACTCACACAATCAAATTAGTTACCATATTAATCAAAATTTTGATAGATTTTTCTCTCCAATAAACTAATTTCATATCCGTAGATATTTTC
ATCTTCTTCAATTTTCTTCATCGCTTTTTTCTTGTTTCATCATTTTGTCTAATACATATGAACTCCTTCATGTTGGATTGGAATTATCCAAATAGTTACA
CCTAATACGAATCAAATCTTTGAATCTGATAATCTCCAATAGACAAAAAAAACAGATTTAAAATGTTACATAATCCTTTAACAATGGCAAATTAAAGTTC
AGAGAAGGCAAAAGCGAAAAAGGATGTACCTGCAACATCGAAAGCAAAAGTTGAAAACAACGAAAAAAATAATCAAAAAGGTTGCCCTGCCATATCTCAT
CAACCTACACTATCCAGGATGGACAAATTTTCTTTGACTTTTGAAGACTTGCCTACAGAAAACAGCGAATTACTTTCGGATATGGACCGAACTGTCTCAC
GACATTCTGAACCCAGCTCACGTACCGGTATTGATTTAATAGGCAGACATTTCTATCTAACACTTTCCAGTATAAATCTTATGGTAGACACCAAACATGT
CCCAAACTTCTCGCTCCCACCGGCCGGCTGATGGAAATAGACTGACTACCGGAGATATTCGTGTTACTTCGTCTGCACTCGAATCGAAGGCCGAATAGAA
AGCATTCCCCCCAGCTGACTATCTTCGTACAAGGTATGCAATAATGTTATGAAAGTATGGTCTCAACTAGGGGTGGGCATTCGGTATTTCGGTTCGATTT
CGAGTTCTTTTTCGGTTTTTTCTATTTCTGATTCTTGTAAATTGTGTACCGAATACCGAACCGAAATATTTCGATTCGATTTTTATTATTTCAGTTTGAT
TTTTTTATTTTGATTTTTT