Detailed information on CNT30508904


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONSLYT000794, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30315993Solanum lycopersicumCorylus avellana62.338.3881.82385forward
CNT30516897Solanum lycopersicumJuglans regia63.1144.1281.54390forward
CNT30377104Solanum lycopersicumArabidopsis thaliana84.7974.2280.53524forward
CNT30269243Solanum lycopersicumChenopodium quinoa77.9952.9180.91482forward
CNT3021339Solanum lycopersicumCitrullus lanatus65.3763.7279.7404forward
CNT30727661Solanum lycopersicumCorchorus capsularis88.8387.778.69549forward
CNT30379051Solanum lycopersicumManihot esculenta57.615182.02356forward
CNT30628927Solanum lycopersicumVigna unguiculata52.9158.3981.65327forward
CNT30195835Solanum lycopersicumPisum sativum36.2588.1981.7224forward
CNT30506120Solanum lycopersicumNicotiana attenuata94.6610088.55585forward
CNT30708121Solanum lycopersicumGlycine max70.7165.8180.09437forward
CNT3042435Solanum lycopersicumPrunus dulcis88.6779.1977.92548forward
CNT3091337Solanum lycopersicumSolanum tuberosum98.7174.7594.43610forward
CNT30307041Solanum lycopersicumTriticum aestivum36.2541.7982.14224forward
CNT30400271Solanum lycopersicumTriticum turgidum58.0972.5380.5359forward
CNT30559890Solanum lycopersicumActinidia chinensis78.9671.4582.58488forward
CNT30591858Solanum lycopersicumMusa acuminata56.6369.0379.14350forward
CNT30554721Solanum lycopersicumOryza glaberrima57.6138.0781.46356forward
CNT30145737Solanum lycopersicumMedicago truncatula54.2154.3882.39335forward
CNT30256655Solanum lycopersicumAvena sativa45.4762.5881.14281forward
CNT30311656Solanum lycopersicumCamelina sativa67.4875.1479.62417forward
CNT3062262Solanum lycopersicumArabidopsis lyrata75.5785.2280.3467forward
CNT3076593Solanum lycopersicumBrassica juncea77.5187.7380.58479forward
CNT30263540Solanum lycopersicumBrassica rapa66.8364.0379.42413forward
CNT30468644Solanum lycopersicumSaccharum spontaneum54.2135.679.4335forward
CNT3017147Solanum lycopersicumZea mays57.6149.7980.9356forward
CNT30607989Solanum lycopersicumGossypium raimondii81.8872.4981.23506forward
CNT30648253Solanum lycopersicumRosa chinensis78.4872.7180.21485forward
CNT30205386Solanum lycopersicumHelianthus annuus49.8443.0881.82308forward
CNT30625502Solanum lycopersicumDaucus carota46.9335.6382.41290forward
CNT30688162Solanum lycopersicumTriticum urartu44.3440.7782.48274forward
CNT30476941Solanum lycopersicumArabidopsis halleri80.5862.1780.52498forward
CNT30596736Solanum lycopersicumOryza meridionalis44.0136.0382.72272forward
CNT30354623Solanum lycopersicumLactuca sativa46.9345.2480.34290forward
CNT30370935Solanum lycopersicumOryza glumipatula44.0128.182.72272forward
CNT30154878Solanum lycopersicumPrunus persica73.1488.6379.2452forward
CNT30408809Solanum lycopersicumPapaver somniferum63.5945.4981.17393forward
CNT30573979Solanum lycopersicumVitis vinifera75.5780.181.37467forward
CNT3028162Solanum lycopersicumTheobroma cacao30.9134.0584.29191forward
CNT3051702Solanum lycopersicumAmborella trichopoda68.7769.4480425forward
CNT30121049Solanum lycopersicumCitrus clementina56.1532.0780.12347forward
CNT3035176Solanum lycopersicumCucumis melo66.3474.5580410forward
CNT30149986Solanum lycopersicumBrachypodium distachyon43.5329.9981.78269forward
CNT30103004Solanum lycopersicumOryza rufipogon44.0127.2883.82272forward
CNT30584450Solanum lycopersicumEchinochloa crusgalli59.0648.7380.55365forward
CNT30176441Solanum lycopersicumVigna angularis85.687.4480.53529forward
CNT30558075Solanum lycopersicumPanicum hallii40.6131.8182.07251forward
CNT30551544Solanum lycopersicumOryza brachyantha6154.2480.9377forward
CNT30335475Solanum lycopersicumCynara cardunculus47.4122.5681.57293forward
CNT3049385Solanum lycopersicumCucumis sativus61.4947.9880.79380forward

Expression of CNT30508904

Peptides detected in this lncRNA

>peptide 1 (53 aa)
MMEKSDYKRVRWGYMKAMWGCKKVKWGCKMAKWGCKMEKWGCRPEKWGCTLEK*

>peptide 2 (72 aa)
MLDYNWVMWVSMKDWLENMLDLSGCSQGSWGYKWGKWGCNQEMWGYNRGKWDCILERSGCNQGMMGCNQGMMD

Sequence

>CNT30508904
ATGGACTAGAAGGAGACAGCTTCGGGCTAGTTGGCGAATACGCAAGGGAGGGGCTGTATCTCGCCGAGGGATTGTAACTTGGTGATGTTGGACTGTAGGA
TGGTGATGTTGGGCTATAGCTGGGAGATGTTGGGCTGTAACCAGGGGAGGTAGGACTGTAAGCAGGAGAAGTCGGACTATATGATGGAGAAGTCGGACTA
TAAGAGGGTGAGGTGGGGCTATATGAAGGCGATGTGGGGCTGTAAGAAGGTGAAGTGGGGCTGTAAGATGGCGAAGTGGGGCTGTAAGATGGAGAAGTGG
GGCTGTAGGCCGGAGAAGTGGGGCTGTACGCTGGAGAAGTAGGGCTGTAGCTAGGTGATGTTGGGCTGTAGCTAGGCGAGGTTGGGCTATAGCTTGGAGA
TGTTGGACTATAACTGGGTGATGTGGGTGAGTATGAAGGACTGGTTGGAGAATATGCTGGACTTGTCGGGCTGTAGCCAGGGGAGCTGGGGCTATAAGTG
GGGGAAGTGGGGCTGTAACCAGGAGATGTGGGGCTATAACCGGGGGAAGTGGGACTGTATCCTGGAGAGGTCGGGCTGTAACCAGGGGATGATGGGCTGT
AACCAGGGGATGATGGAC