Detailed information on CNT30508703


BLAST search results

BLAST vs Swiss-Prot:
sp|P07370|CB2B_SOLLC, E-value = 0.0

BLAST vs NONCODE:
NONSTUT001352, E-value = 5e-168

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30633518Solanum lycopersicumCapsicum annuum96.73100.2292.69916forward
CNT3091810Solanum lycopersicumSolanum tuberosum92.592.4195.32876forward
CNT30562273Solanum lycopersicumActinidia chinensis65.7962.8788.6623forward
CNT30313626Solanum lycopersicumCamelina sativa67.5855.5181.72640forward
CNT30598305Solanum lycopersicumFraxinus excelsior45.262.6687.62428forward
CNT30137839Solanum lycopersicumLolium perenne61.0375.4682.87578forward
CNT30609649Solanum lycopersicumGossypium raimondii61.6777.1585.96584forward
CNT30714756Solanum lycopersicumMalus domestica golden55.3351.6385.69524forward
CNT30725273Solanum lycopersicumLupinus angustifolius68.6463.1186.46650forward

Expression of CNT30508703

Peptides detected in this lncRNA

>peptide 1 (67 aa)
MPRGLQQGLMGRSCHRGRVGRQPHQEVHQQYGNLQRLPSRQLGKPRWLRCSVHGPSLGCPSSQVLPR*

>peptide 2 (47 aa)
MVILPFPEISEAEGESFTACPAKEGEERAIVAAAMVFKERKMRELLV*

>peptide 3 (38 aa)
SKLTTKTLQSHQTIISREHFMIFICREQSLWQRPMHCC*

>peptide 4 (36 aa)
MDQAWVAQVVKSSLAEDLGSGLEPHSLTELDTVTGQ*

Sequence

>CNT30508703
CAAGTAAACTCACAACTAAAACTTTACAAAGCCATCAAACAATAATATCTAGAGAACATTTTATGATATTCATTTGCCGGGAACAAAGTTTGTGGCAAAG
GCCCATGCATTGTTGTTAACTGGATCTGCAAGGTGGTCAGCAAGGTTCTCCAATGGACCCTTTCCGGTAACAATGGCCTGAACAAAGAATCCGAACATAG
AGAACATAGCAAGTCTGCCGTTCTTAATCTCCTTTACCTTGAGCTCAGCAAATGCCTCGGGGTCTTCAGCAAGGCCTAATGGGTCGAAGCTGCCACCGGG
GTAGAGTGGGTCGACAACCTCACCAAGAGGTCCACCAGCAATACGGTAACCTTCAACGGCTCCCATCAAGACAACTTGGCAAGCCCAGATGGCTAAGATG
CTCTGTGCATGGACCAAGCTTGGGTTGCCCAAGTAGTCAAGTCCTCCCTCGCTGAAGATCTGGGATCCGGCCTTGAACCACACAGCCTCACCGAACTTGA
CACCGTTACGGGCCAATAGCTCAGGGAAGACACATCCAAGAGCACCAAGCATAGCCCATCTGCAGTGGATCACCTCGAGTTCACGGTTCTTGGCAAAGGT
TTCAGGGTCTGCTGAGAGTCCAGCGGTATCCCAGCCGTAGTCACCAGGGAATTCACCAGTCAAGTAGCTTGGGGACTCACCAGAGAATGGGCCCAAGTAC
TTAACACGGTCAGGGCCATACCATGGACTGCTAGATGGGGCAGACTTGGCAACAGCCTTTCTCATGGTGATCCTTCCATTTCCAGAGATTTCTGAGGCAG
AGGGTGAGAGTTTCACTGCCTGTCCGGCAAAAGAAGGAGAAGAAAGAGCCATTGTAGCAGCTGCCATGGTTTTTAAAGAGAGGAAAATGAGGGAGTTGCT
AGTTTGATATGTAAAAGTTAGTTGTGATGAGCTGAAGTTATTGAAAC