CANTATAdb - search

Detailed information on CNT30501219

BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)

Target	Query species	Target species	Query coverage (%)	Target coverage (%)	Identity	Alignment length (nt)	Orientation
CNT30535409	Coffea canephora	Eucalyptus grandis	28.08	31.01	89.89	89	forward
CNT30315642	Coffea canephora	Corylus avellana	27.13	17.84	90.7	86	reverse complement
CNT30547454	Coffea canephora	Ipomoea triloba	25.55	24.7	85.19	81	reverse complement
CNT30703316	Coffea canephora	Quercus lobata	25.55	26.38	88.89	81	reverse complement
CNT30376791	Coffea canephora	Arabidopsis thaliana	19.56	20.33	88.71	62	reverse complement
CNT30618136	Coffea canephora	Sesamum indicum	29.65	16.52	87.23	94	forward
CNT30272829	Coffea canephora	Chenopodium quinoa	26.18	27.04	90.36	83	reverse complement
CNT3069056	Coffea canephora	Quercus suber	25.55	7.66	86.42	81	reverse complement
CNT30381728	Coffea canephora	Manihot esculenta	21.45	22.08	88.24	68	reverse complement
CNT30403856	Coffea canephora	Beta vulgaris	24.92	25.65	92.41	79	reverse complement
CNT30526114	Coffea canephora	Phaseolus vulgaris	28.71	29.93	89.01	91	reverse complement
CNT30629861	Coffea canephora	Vigna unguiculata	26.81	17.93	84.71	85	reverse complement
CNT30507014	Coffea canephora	Nicotiana attenuata	30.91	31.72	89.8	98	reverse complement
CNT30711418	Coffea canephora	Glycine max	28.71	29.93	87.91	91	reverse complement
CNT3045640	Coffea canephora	Prunus dulcis	29.34	30.19	89.25	93	reverse complement
CNT30634223	Coffea canephora	Capsicum annuum	27.76	30.14	85.23	88	forward
CNT3093739	Coffea canephora	Solanum tuberosum	28.08	29.28	87.64	89	reverse complement
CNT30561829	Coffea canephora	Actinidia chinensis	28.39	25.21	90	90	reverse complement
CNT3086859	Coffea canephora	Vigna radiata	28.71	30.13	89.01	91	reverse complement
CNT30544072	Coffea canephora	Brassica napus	25.55	26.82	86.42	81	reverse complement
CNT30235645	Coffea canephora	Brassica oleracea	22.4	23.13	85.92	71	reverse complement
CNT30508652	Coffea canephora	Solanum lycopersicum	25.24	26.32	88.75	80	reverse complement
CNT3061108	Coffea canephora	Arabidopsis lyrata	14.83	20.52	91.49	47	forward
CNT30262244	Coffea canephora	Brassica rapa	25.55	26.73	86.42	81	reverse complement
CNT30653438	Coffea canephora	Rosa chinensis	24.61	25.32	92.31	78	reverse complement
CNT30128358	Coffea canephora	Corymbia citriodora	26.18	30.07	85.54	83	forward
CNT30625980	Coffea canephora	Daucus carota	24.61	25.57	85.9	78	reverse complement
CNT30154558	Coffea canephora	Prunus persica	29.34	30.39	89.25	93	reverse complement
CNT30410045	Coffea canephora	Papaver somniferum	21.14	22.64	88.06	67	forward
CNT30572433	Coffea canephora	Vitis vinifera	29.65	17.06	85.11	94	forward
CNT3024632	Coffea canephora	Populus trichocarpa	27.13	28.38	90.7	86	reverse complement
CNT30120686	Coffea canephora	Citrus clementina	28.39	29.9	87.78	90	forward
CNT30175002	Coffea canephora	Vigna angularis	28.71	30.43	86.81	91	reverse complement
CNT3050759	Coffea canephora	Cucumis sativus	19.56	20.26	91.94	62	reverse complement

Expression of CNT30501219

Peptides detected in this lncRNA

>peptide 1 (33 aa)
MGEPVNSPTVLPSGPIQRSNTLMPLLRLQARATK

Sequence

>CNT30501219
GGGAAAACAAAAAATTGAAAAAAAGTGTTGGTTCAATTAGGAATGCCCATCTGGTAATAGTGGACTAGTGGAGCACCAGCCCGTTATCCTTCCACTGCAA
GGAGCGGGAAGTTCTCGTTGCTCTGTCAAACCAGCCTCACGCAGTGCCCTCCACTTTAGGAGCCAAGCGGTCTCAGCCTCCGCCAAGTCCGCATGACCCA
GCTCTTCGCTTGGAATGGGCGAGCCAGTGAATAGCCCTACCGTCCTACCATCCGGACCAATCCAACGTTCCAACACATTAATGCCCCTGCTCAGGTTACA
AGCTCGCGCTACCAAGC