Detailed information on CNT30478355


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30478355

Peptides detected in this lncRNA

>peptide 1 (36 aa)
MKDSKAESQEFLQVEGNQTSQVDLSYRFFFSNLFSNV

Sequence

>CNT30478355
AGACCATCTCCAATGGGGAGAAAATTGAGTTCTCATGAGAAGCTCTCTCATCAATTGTGAAAAAAAATAAATCAGAAAGGATTTATTTTGAGAGAGCTGT
TTATCTTAAGAGAACTTTTGGTGGTGAAGAGAGACGTACACGTGTCCATTTCTCTGCAAATTTTCTTCACTTTCATCTTTGATCTCTCTGCAAATTTTCT
TCACTTCCAGCTCCGACGATTGAGAGTAGAATTGAAGCTAATTTCCTTTAATCATTCCAAATTTTGCAAACTAATTTCTTCACTTTCATCTTTGATCTCT
CTGGAAAAAAAACTAATTTGAGTTTTTGGAATTAACTTGTAAAATTTTTCTCTGCAGTGGAAACTGTCGGTTGGGCTTCTGATCGGTTTGCAACCGATCG
GATCTCTTTAGTATATTTTTGCAATTTTGCCGCTCGGTTTCGTCGATCGGTTGTAAACCGATCGGATTGTAACTTTTGCTCCGCAACTCCGTTTCAGACA
AACTCACCACCGTTGGAAAGCTAATTCAATTTCCTACAACTTTCATGAAGGGCTCCAAAGCTAAATAACAGAGGAGAGTCTTCATATAATGTGATCTTTC
AAGAACTTCATTTGGAGCCATCATCTAGATCGAGTGTAGACCGATCTGTTTGTAACTTTTGATACGCTACTCCGTTTGATACGAAATCACCACCATTAGA
AAGCTGATTCAATTCTCTATAACTTTCATGAAGGACTCCAAAGCTGAATCACAAGAATTCCTACAAGTTGAAGGAAACCAAACTTCACAAGTCGATTTAT
CGTATCGTTTTTTTTTTTCAAATTTATTTTCAAATGTATG