Detailed information on CNT30478171


BLAST search results

BLAST vs Swiss-Prot:
sp|P10896|RCA_ARATH, E-value = 5e-61

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30697166Arabidopsis halleriOryza sativa16.4822.1381.4129forward
CNT30374643Arabidopsis halleriArabidopsis thaliana35.2557.0294.2276forward
CNT30123072Arabidopsis halleriPhyscomitrium patens13.0333.7784.31102forward
CNT30309961Arabidopsis halleriCamelina sativa36.7849.7494.79288forward
CNT3061026Arabidopsis halleriArabidopsis lyrata50.45101.0295.7395forward
CNT3074932Arabidopsis halleriBrassica juncea37.0491.7788.62290forward
CNT30261873Arabidopsis halleriBrassica rapa34.3696.4289.22269forward
CNT30115081Arabidopsis halleriEutrema salsugineum14.6941.0785.22115forward

Expression of CNT30478171

Peptides detected in this lncRNA

>peptide 1 (51 aa)
LTECAKLCIGRRRNVVYDKAILNYQCVAHAHKKKGTKEDKTQSTVTQKGKK*

>peptide 2 (72 aa)
MFPYSISFSRVISGCSNTGGPSLEFTNLFPIFSTPSPSTNFLTSSSYTLALKAPKKSVHTKKHKSYSARGPI*

Sequence

>CNT30478171
TTAACAGAATGTGCAAAACTATGCATTGGAAGAAGGAGAAATGTAGTTTATGACAAGGCAATTTTAAATTACCAATGTGTTGCACATGCTCATAAAAAAA
AAGGAACAAAAGAGGACAAGACCCAATCCACAGTTACACAAAAGGGGAAAAAATAACCAAAAGAGACAATAGGAGTAAAACAGCAAATTAATAAGCAGGA
TAATATTGCTCAAAAGTTGTAGACACAGGATCAGTACACCCTTCAGGAACAGGCAGGCTTACTTGCTGGGCACCTTTTCCTGCAAGTCAAGTAAGTTTAA
CTTCAGAAAACCTAATTCCATTTTCTTCTTCTCTTTAATAATTTGGGTCATATCCCAAGGTTTAATCCCGTGGCCAGCCAAACCAAAAAACATAGGAGTT
TCAAACCTCTGTTTTACCGTAGAAAGTTCCGCGGTCGATGGCGTCAGCGTTTGCGTCTCCCAACGCAGCCTGGCTGAGGTAAGTGTCGGCAAGTTGGACT
CTCTTGACATTCTCTTGTTCCATCACGAGCATGTTTCCGTACTCCATAAGCTTCTCAAGAGTCATCTCGGGTTGCTCAAACACGGGAGGTCCTTCCCTTG
AGTTCACCAACCTCTTTCCGATCTTCTCCACTCCAAGTCCCTCGACGAACTTCCTCACTTCATCATCGTACACTCTCGCCCTCAAGGCACCGAAGAAATC
TGTCCACACGAAAAAACACAAATCATATTCTGCACGAGGTCCTATATAGAACATTTTCAGGGTAGTAAGAATCTTTCTTACCG