Detailed information on CNT30478004


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30478004

Peptides detected in this lncRNA

>peptide 1 (46 aa)
MQWTIVGICHSIKFQVCILEVIVHKLISVLSEHQKGYMDNYHPENH*

Sequence

>CNT30478004
TTGAAAAGGAAAATGAACTGAGGGAAGACGCTGGGAACTTGATGGGAATATTGTAGAAAGCGTGACCGGTGCTTGTGCTTGTATTATTTGTTAGATGCAA
TGGACCATCGTCGGTATTTGCCATTCCATCAAGTTTCAGGTCTGCATTCTTGAAGTTATAGTACACAAATTGATCTCCGTCTTGAGCGAACACCAAAAAG
GTTACATGGACAATTATCATCCAGAAAACCACTGATCCTAGAACTCCAGCCATCAGGAACAACGATGATCT