Detailed information on CNT30477236


BLAST search results

BLAST vs Swiss-Prot:
sp|P31156|METK2_PETCR, E-value = 1e-31

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30374327Arabidopsis halleriArabidopsis thaliana98.3490.191.75473forward
CNT3096210Arabidopsis halleriSolanum tuberosum28.4822.0381.02137forward
CNT3014405Arabidopsis halleriZea mays22.8720.3781.82110forward
CNT30355713Arabidopsis halleriLactuca sativa19.5421.7182.9894forward

Expression of CNT30477236

Peptides detected in this lncRNA

>peptide 1 (38 aa)
KGKNSKHKTQIFHLQSSITRYMNRWPRVRENKCEWCGL*

Sequence

>CNT30477236
AAAAGGGCAAAAATTCAAAACATAAAACTCAAATCTTTCATTTGCAATCTTCAATTACCAGATATATGAACCGCTGGCCTCGTGTTCGCGAAAACAAATG
TGAATGGTGTGGATTATAGAGATCTGATGAAAATGCAGAAGCTTTATTCAATCATTTGCAATAATAATGGTATCATGATAAGTTCCCAGTAGTTGGGGAG
TCGCTCAACTCAGTTCTTGCAATTACCAGCTTTGTTTATGTTTAGGCCTTTGGCTTGAGCGGCTTGACGACCTCCCAAGTGAAGTCAGGGTTAATGGCCA
TCATTCCCGGCCTGAAGTCAAATGCTTCCTTGATCAACACAAGGATATCCTTGTCTGGGATGGTCCCGGTCTTGTAGGTGTCAACAAACACTGAGAGCGG
CTCAGGGACACCAATGGCGTATGATACCTGCACGATACAGCGGCGTGCGAGCCCTGCTGCTACCACACTCTTTGCAGCCTG