Detailed information on CNT30476641


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONZMAT004551, E-value = 2e-38

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30476641

Peptides detected in this lncRNA

>peptide 1 (57 aa)
MYHACDPRLAMLSTKPIFKCLAHNRACMVLTVCLYVRKYFSSLNSKVRFDTGATICMQ

>peptide 2 (44 aa)
MARRCARTLYLYQCIGRSSNPIPCTLFLSKPLRKLAMYNLYVYY*

>peptide 3 (54 aa)
MRARVGADDREIMQSSARHRSRSRARTTTARRPRPQRRRRRRPRRGRHAWQTCP*

>peptide 4 (34 aa)
LAIPSCLHTYGSTCIETNLTVQRREILPYIQTYS*

>peptide 5 (41 aa)
MISRSSAPTRAPMGAGSALEPARHGTPLRADLVLVSMYREE*

>peptide 6 (31 aa)
MPCRFKRAAGAHARARWGRRSRDHAKLGTTP*

>peptide 7 (78 aa)
LPSLVACIHMVAPVSKRTLLFNEEKYFLTYRHTVKTIHARLCAKHLKIGLVESMANLGSHAWYIGTTVTSTSLRQLVR*

Sequence

>CNT30476641
GCTTGCCATCCCTAGTTGCCTGCATACATATGGTAGCACCTGTATCGAAACGAACCTTACTGTTCAACGAAGAGAAATACTTCCTTACATACAGACATAC
AGTTAAGACCATACACGCTCGATTGTGTGCCAAACATTTGAAGATCGGCTTGGTCGAAAGCATGGCCAATCTAGGATCACATGCATGGTACATTGGTACT
ACTGTAACTAGCACAAGTTTACGACAACTTGTGCGATAGATTCATGATTCAGTAGTAGCGGCTACTGCAGTTTCTTACTAGTAGTATACATACAAATTAT
ACATCGCTAGTTTACGCAAGGGCTTGCTCAAAAAGAGAGTACATGGGATAGGATTGCTACTCCTCCCTATACATTGATACAAGTACAAGGTCCGCGCGCA
ACGGCGTGCCATGCCGTGCCGGTTCAAGCGCGCTGCCGGCGCCCATGCGCGCGCGCGTTGGGGCCGACGATCGAGAGATCATGCAAAGCTCGGCACGACA
CCGTAGCCGAAGTCGAGCACGTACGACGACGGCACGGCGGCCTCGGCCTCAGCGTCGTCGGCGTCGGCGTCCCCGTCGTGGTCGGCACGCTTGGCAAACC
TGCCCTTGATCCGCGGCCGCCGTGCCGTCGTCGTACGTGCTCGACTTCGGCTACGGTGTCGTGCCGAGCTTTGCATGATCTCTCGATCGTCGGCCCCAAC
GCGCGCGCCCATGGGCGCCGGCAGCGCGCTTGAACCGGCACGGCATGGCACGCCGTTGCGCGCGGACCTTGTACTTGTATCAATGTATAGGGAGGAGTAG
CAATCCTATCCCATGTACTCTCTTTTTGAGCAAGCCCTTGCGTAAACTAGCGATGTATAATTTGTATGTATACTACTAGTAAGAAACTGCAGTAGCCGCT
ACTACTGAATCATGAATCTATCGCACAAGTTGTCGTAAACTTGTGCTAGTTACAGTAGTACCAATGTACCATGCATGTGATCCTAGATTGGCCATGCTTT
CGACCAAGCCGATCTTCAAATGTTTGGCACACAATCGAGCGTGTATGGTCTTAACTGTATGTCTGTATGTAAGGAAGTATTTCTCTTCGTTGAACAGTAA
GGTTCGTTTCGATACAGGTGCTACCATATGTATGCAGG