Detailed information on CNT30476389


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30670715Saccharum spontaneumSetaria viridis34.6944.1692.16102forward
CNT30519985Saccharum spontaneumSetaria italica40.1443.3890.68118forward
CNT3016231Saccharum spontaneumZea mays35.0318.8395.15103forward
CNT30368795Saccharum spontaneumSorghum bicolor52.7229.8194.84155forward

Expression of CNT30476389

Peptides detected in this lncRNA

>peptide 1 (96 aa)
LGVEEALADVRLLGLVQVGDDAFLLLLGLLLGLGGRLDGGVSGGRLRPDGGRGRREGDGRGHDCSGHGGQQQQQLHSDVRFWGAKSGGGRTGGGGEG

>peptide 2 (96 aa)
LVLRRHLPTYGSLGLYKLVTTPSSCFLDSFLDLAGASTAVSVADACARMAAEDDGKETAAAMTVVAMAASSSSSYTVTYGSGVRKVEAAGPEAEGRG

Sequence

>CNT30476389
TCTTGGTGTTGAGGAGGCACTTGCCGACGTACGGCTCCTTGGGCTTGTACAAGTTGGTGACGACGCCTTCCTCCTGCTTCTTGGACTCCTTCTTGGACTT
GGCGGGCGCCTCGACGGCGGTGTCAGTGGCGGACGCCTGCGCCCGGATGGCGGCCGAGGACGACGGGAAGGAGACGGCCGCGGCCATGACTGTAGTGGCC
ATGGCGGCCAGCAGCAGCAGCAGCTACACAGTGACGTACGGTTCTGGGGTGCGAAAAGTGGAGGCGGCCGGACCGGAGGCGGAGGGGAGGGGAG