Detailed information on CNT30476314


BLAST search results

BLAST vs Swiss-Prot:
sp|P47815|IF1A_WHEAT, E-value = 2e-93

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30521379Saccharum spontaneumSetaria italica59.5965.2996.83410forward
CNT30616469Saccharum spontaneumSesamum indicum34.7432.381.17239forward
CNT30708734Saccharum spontaneumGlycine max39.5348.0686.76272forward
CNT30102311Saccharum spontaneumOryza rufipogon39.5340.6693.01272forward
CNT30576889Saccharum spontaneumOryza barthii36.1938.0292.37249forward

Expression of CNT30476314

Peptides detected in this lncRNA

>peptide 1 (67 aa)
MSPAAIQTFLCILPRMWQRRRVPSTQMASHRPLPSIRVTCAYSCPSSLKTSSRLSSSASFFPLFRFLP

>peptide 2 (71 aa)
MYQIKNEIIRDYLTTPILLQDHAGRIANPQQPAKPKPYHHILEQKSHNNKVARKEKQLYQILSMSSSSNWM*

Sequence

>CNT30476314
TTGACTCAAAGAAAACTGGGTCTAGTTGGCAAATCAAACAATATATAAGAGAACACAATCCAGAACAATAATAACTTAGTATAGAACATCCTGTGACAGC
ATGTACCAGATTAAAAACGAAATTATCCGCGATTATTTAACCACCCCAATCCTATTACAAGATCACGCAGGCAGGATTGCGAATCCACAACAGCCAGCCA
AGCCTAAACCATACCACCACATACTAGAACAGAAGTCACACAATAATAAAGTAGCCCGCAAGGAGAAACAGCTTTATCAGATCTTGTCGATGTCCTCGTC
CTCGAACTGGATGTAGTCGCTGCCCTCCTCGCCGTCCTCGGGCCCATCGACGTCGACGCCCTCGTTGAGCCTGAGCGTCTCGGGGAGCTCCCCGTAGGCC
TTGAGCAGGCGCGCCTCGTCGTTCAGGTACTTGAGGATGACGTCGGCCTTGTCGTCCTGGTAGTCGCGGAGGCCGACGAGGACGATGTCCCCGGCCGCGA
TCCAGACCTTCTTGTGCATCTTGCCCCGGATGTGGCAGAGGCGGCGCGTGCCATCGACGCAGATGGCCTCGCACCGCCCGTTGCCGAGCATCCGGGTCAC
CTGCGCGTACTCCTGCCCGTCTTCCTTGAAGACGAGCTCGCGCTTGTCGTCGTCGGCCTCGTTCTTTCCCCTCTTCCGGTTCTTGCCT