Detailed information on CNT30476018


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30476018

Peptides detected in this lncRNA

>peptide 1 (45 aa)
MEMKSLKAWWRSLKPTPLLLNTWKVGRRMAIWWDDSWRTKRIEIL*

>peptide 2 (49 aa)
IKHHPSRRLDLAEVGELLAAAVAIVESLSVVAEPHTQDLQEDPEPPYTT*

>peptide 3 (32 aa)
NQTSSKPPLGSRRGRRAACRRCGHRREPLRRC*

>peptide 4 (68 aa)
MLLRLSEQDTGCLHAEGRRHSVTIVHAAAKPSQSAHSTESIENLTRIHGKKCCLQLHQDGRIAALMVA*

Sequence

>CNT30476018
AATCAAACATCATCCAAGCCGCCGCTTGGATCTCGCCGAGGTCGGAGAGCTGCTTGCCGCCGCTGTGGCCATCGTAGAGAGCCTCTCCGTCGTTGCTGAG
CCTCACACTCAGGATTTGCAAGAAGACCCGGAGCCACCATACACGACTTGAAATCTCGCCGAGGTGCCAAGCTCATCCGCCGAAGTCGCCGCAGCCGTCG
GATGCTCCTCCGTCTATCCGAGCAGGACACCGGTTGTCTACACGCGGAAGGTCGCCGTCATTCCGTTACAATCGTGCACGCTGCCGCTAAGCCTTCTCAG
TCCGCACATAGCACCGAGAGCATTGAGAACTTGACTCGGATCCATGGGAAGAAGTGTTGCCTACAGCTCCACCAAGATGGGCGAATTGCAGCACTGATGG
TGGCCTAGCTGCAGTTGCACCCAAAGGACCAACACTTTCATGGAGATGAAATCCTTGAAAGCTTGGTGGAGGAGCTTGAAGCCAACTCCTCTGCTGTTGA
ACACCTGGAAAGTTGGGAGGAGAATGGCCATATGGTGGGACGATTCCTGGAGGACCAAAAGGATTGAAATTCTGTAGAAAATTGGATGTTGTTGTGGGAA
ACTAAGATTGGGGTGTAGGAGGTGAGAACTGGCCAGTACCCTCTGATGAGTATTGGGATGGAGAACCCTGATTCAAGAGGTTTGTGTAGTTTCTAGGGTT
AGGTTCCATTGCAAGGAGTTGTGTTCTAGAGTGAAGAGGAGGCCAACGCTGGCAAGTTTTTGAAAAGGCAGCAAGCAGCCAAGTGAAAGAGGTGGCCAAC
GCCTTCAGTTTCCCTTCAGTTTTGTAGAGGCAGAGCTGGGACGTAGAAGAGGAGGCCAACGGCCAACGGCCAACGGCTAGCTTCTGGAACCAACGGCTCC
TTACTTTGTGTCAGATGTACAATACAAATACAATTTTTTATTTGCTTATGGGCTGCCCATAGTGCTATGGGTAGCTTTTTCTATTTCTTTCCTATGGACT
ACAGCCACAATGTATCAGTCACCTGGTAGGAAATATTTAATTCAC