Detailed information on CNT30475699


BLAST search results

BLAST vs Swiss-Prot:
sp|Q8GXR9|NDC1_ARATH, E-value = 5e-48

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30521410Saccharum spontaneumSetaria italica14.0724.3496.08102forward

Expression of CNT30475699

Peptides detected in this lncRNA

>peptide 1 (51 aa)
AFCTEASESIAVFVNQLIPTFTRCSSVGILRQYTSFRAAEQSSISVTPRRK*

>peptide 2 (49 aa)
MTSSAGLQHQPEEKPSKSLTCAVAGRSLPDGSLRAAESPIANVRGWPFT*

>peptide 3 (35 aa)
MDPLELLNRQSQMSGDGLLLEGFPLSPPAPDHSEE*

Sequence

>CNT30475699
TGCGTTTTGCACGGAGGCAAGTGAATCGATCGCAGTCTTTGTGAACCAGCTGATTCCAACCTTCACCCGGTGTTCATCCGTGGGCATTCTGAGGCAGTAC
ACGAGCTTCCGAGCTGCAGAGCAAAGTTCAATTTCAGTTACGCCTAGGCGAAAGTGAATGAGCATGCTTCAAAGTGTTCATACCAGCATGTCCTAGAGGT
CCTTCCAAGAGATTCCATCCTGCAAAATCTGCTTGTTGAAAGGCAACCTAGGAGATAAGAGTTTCTTTAGTGACATGACTAGCAGTGCAGGCTTGCAGCA
TCAGCCTGAAGAAAAACCCAGCAAATCTCTTACCTGTGCAGTGGCAGGGAGGAGTTTGCCTGATGGATCCCTTAGAGCTGCTGAATCGCCAATCGCAAAT
GTCCGGGGATGGCCTTTTACTTGAAGGGTTTCCTCTGTCTCCACCTGCCCCCGACCATTCAGAGGAATAACATAGGGAGCATCAGGAGGCTGTAACCGGG
GAATCTGAGATGTTGAACCCACTGTCCACAGCACCAAATCGGCCTCAAGAGTCTGGCCTTTGAGTCCTCTTTCAGCAGGTTGAAGGTCCAAAATTAGTTT
CCTATGATCACCGTCAACTTCAGAGTATGTAACTGTGCTACTTGAATCATCAGATGCAGAAGCCTCTTTAATGCAGGTCACAAAATATCCCAAGAAAAGC
TGAATATTCCGAGACTCAAGAACCT